BLASTX nr result
ID: Cnidium21_contig00036295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00036295 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514413.1| cysteine protease, putative [Ricinus communi... 169 3e-40 ref|XP_002328138.1| predicted protein [Populus trichocarpa] gi|2... 165 4e-39 ref|XP_002306996.1| predicted protein [Populus trichocarpa] gi|2... 164 9e-39 ref|XP_002510720.1| cysteine protease, putative [Ricinus communi... 163 1e-38 ref|XP_003603871.1| Cysteine proteinase [Medicago truncatula] gi... 159 3e-37 >ref|XP_002514413.1| cysteine protease, putative [Ricinus communis] gi|223546510|gb|EEF48009.1| cysteine protease, putative [Ricinus communis] Length = 324 Score = 169 bits (427), Expect = 3e-40 Identities = 74/95 (77%), Positives = 92/95 (96%) Frame = +3 Query: 3 INQIVTGNLTSLSEQELVDCDTSFDNGCHGGLMEHAFTYIMTHGGLHKEEDYPYIMKEGT 182 INQIVTGNLTSLSEQEL+DCDTSF++GC+GGLM++AF YI+ +GGLHKEEDYPY+M+EGT Sbjct: 142 INQIVTGNLTSLSEQELIDCDTSFNSGCNGGLMDYAFDYIVNNGGLHKEEDYPYLMEEGT 201 Query: 183 CDEKKDEAEVVTINGYHNIPKNSEESMLKALAHQP 287 CDEK++E EVVTI+GYH++P+N+EES+LKALAHQP Sbjct: 202 CDEKREEMEVVTISGYHDVPENNEESLLKALAHQP 236 >ref|XP_002328138.1| predicted protein [Populus trichocarpa] gi|222837653|gb|EEE76018.1| predicted protein [Populus trichocarpa] Length = 349 Score = 165 bits (417), Expect = 4e-39 Identities = 71/95 (74%), Positives = 90/95 (94%) Frame = +3 Query: 3 INQIVTGNLTSLSEQELVDCDTSFDNGCHGGLMEHAFTYIMTHGGLHKEEDYPYIMKEGT 182 INQIV GNLTSLSEQ+L+DCDTSF+NGC+GGLM++AF +I+ +GGLHKEEDYPY+M+EGT Sbjct: 167 INQIVAGNLTSLSEQQLIDCDTSFNNGCNGGLMDYAFEFIVNNGGLHKEEDYPYLMEEGT 226 Query: 183 CDEKKDEAEVVTINGYHNIPKNSEESMLKALAHQP 287 CDEK++E EVVTI+GYH++P+N E+S+LKALAHQP Sbjct: 227 CDEKREEMEVVTISGYHDVPRNDEQSLLKALAHQP 261 >ref|XP_002306996.1| predicted protein [Populus trichocarpa] gi|222856445|gb|EEE93992.1| predicted protein [Populus trichocarpa] Length = 336 Score = 164 bits (414), Expect = 9e-39 Identities = 73/95 (76%), Positives = 92/95 (96%) Frame = +3 Query: 3 INQIVTGNLTSLSEQELVDCDTSFDNGCHGGLMEHAFTYIMTHGGLHKEEDYPYIMKEGT 182 INQIVTGNLTSLSEQELVDCDT+++NGC+GGLM++AF YI+++GGLHKEEDYPYIM+EGT Sbjct: 154 INQIVTGNLTSLSEQELVDCDTTYNNGCNGGLMDYAFAYIISNGGLHKEEDYPYIMEEGT 213 Query: 183 CDEKKDEAEVVTINGYHNIPKNSEESMLKALAHQP 287 C+ +K E+EVVTI+GYH++P+NSEES+LKALA+QP Sbjct: 214 CEMRKAESEVVTISGYHDVPQNSEESLLKALANQP 248 >ref|XP_002510720.1| cysteine protease, putative [Ricinus communis] gi|223551421|gb|EEF52907.1| cysteine protease, putative [Ricinus communis] Length = 349 Score = 163 bits (413), Expect = 1e-38 Identities = 71/95 (74%), Positives = 91/95 (95%) Frame = +3 Query: 3 INQIVTGNLTSLSEQELVDCDTSFDNGCHGGLMEHAFTYIMTHGGLHKEEDYPYIMKEGT 182 INQIVTGNLTSLSEQEL+DCDT+++NGC+GGLM++AF YI+ +GGLHKEEDYPYIM+EGT Sbjct: 167 INQIVTGNLTSLSEQELIDCDTTYNNGCNGGLMDYAFAYIVANGGLHKEEDYPYIMEEGT 226 Query: 183 CDEKKDEAEVVTINGYHNIPKNSEESMLKALAHQP 287 CD +K+E++ VTI+GYH++P+NSEES+LKALA+QP Sbjct: 227 CDMRKEESDAVTISGYHDVPQNSEESLLKALANQP 261 >ref|XP_003603871.1| Cysteine proteinase [Medicago truncatula] gi|355492919|gb|AES74122.1| Cysteine proteinase [Medicago truncatula] gi|388499154|gb|AFK37643.1| unknown [Medicago truncatula] Length = 350 Score = 159 bits (401), Expect = 3e-37 Identities = 69/95 (72%), Positives = 91/95 (95%) Frame = +3 Query: 3 INQIVTGNLTSLSEQELVDCDTSFDNGCHGGLMEHAFTYIMTHGGLHKEEDYPYIMKEGT 182 INQIVTGNLTSLSEQEL+DCDT+++NGC+GGLM++AF++I+ +GGLHKEEDYPYIM+E T Sbjct: 168 INQIVTGNLTSLSEQELIDCDTTYNNGCNGGLMDYAFSFIVKNGGLHKEEDYPYIMEEST 227 Query: 183 CDEKKDEAEVVTINGYHNIPKNSEESMLKALAHQP 287 C+ KK+ +EVVTINGYH++P+N+E+S+LKALA+QP Sbjct: 228 CEMKKEVSEVVTINGYHDVPQNNEQSLLKALANQP 262