BLASTX nr result
ID: Cnidium21_contig00036283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00036283 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004161848.1| PREDICTED: pentatricopeptide repeat-containi... 72 4e-11 ref|XP_004137635.1| PREDICTED: pentatricopeptide repeat-containi... 72 4e-11 ref|XP_002267777.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-09 ref|XP_003624391.1| Pentatricopeptide repeat-containing protein ... 61 8e-08 ref|XP_003533536.1| PREDICTED: pentatricopeptide repeat-containi... 47 6e-06 >ref|XP_004161848.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Cucumis sativus] Length = 769 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +2 Query: 2 GDIDTATRAAQHALNLDRHTPSTYVLLSNTFADTSNWDAVGTLRKLM 142 GDI+T RAA+HALNLDR+ PSTY+LLSN FA NWD+VG LR+LM Sbjct: 701 GDIETGKRAAEHALNLDRNDPSTYILLSNMFAGGDNWDSVGILRELM 747 >ref|XP_004137635.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Cucumis sativus] Length = 769 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +2 Query: 2 GDIDTATRAAQHALNLDRHTPSTYVLLSNTFADTSNWDAVGTLRKLM 142 GDI+T RAA+HALNLDR+ PSTY+LLSN FA NWD+VG LR+LM Sbjct: 701 GDIETGKRAAEHALNLDRNDPSTYILLSNMFAGGDNWDSVGILRELM 747 >ref|XP_002267777.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Vitis vinifera] gi|296087996|emb|CBI35279.3| unnamed protein product [Vitis vinifera] Length = 598 Score = 61.6 bits (148), Expect(2) = 2e-09 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = +2 Query: 2 GDIDTATRAAQHALNLDRHTPSTYVLLSNTFADTSNWDAVGTLRKLM 142 GD++T AA+ AL+LD+H STYV+LSN FAD NW VG+LR+LM Sbjct: 533 GDVETGLLAAKQALSLDKHDSSTYVVLSNMFADGRNWKGVGSLRELM 579 Score = 25.0 bits (53), Expect(2) = 2e-09 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +3 Query: 147 SRDVKKRSGSSWI 185 +RDVKK GSSWI Sbjct: 581 TRDVKKMPGSSWI 593 >ref|XP_003624391.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355499406|gb|AES80609.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 709 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = +2 Query: 2 GDIDTATRAAQHALNLDRHTPSTYVLLSNTFADTSNWDAVGTLRKLM 142 GD++T AA+HA+ D++ PS+YVLLSN A+TSNWD V +LR+LM Sbjct: 491 GDVETGKLAAEHAIKHDKNDPSSYVLLSNMLAETSNWDCVVSLRELM 537 >ref|XP_003533536.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Glycine max] Length = 694 Score = 46.6 bits (109), Expect(2) = 6e-06 Identities = 23/54 (42%), Positives = 29/54 (53%) Frame = +2 Query: 11 DTATRAAQHALNLDRHTPSTYVLLSNTFADTSNWDAVGTLRKLMGKSGC*EEVG 172 D R A+ L +D H TY LLSN +A WD V T+RKLM + +E G Sbjct: 508 DLGRRIAESVLQMDPHDVGTYTLLSNMYAKARRWDGVVTIRKLMRERNIKKEPG 561 Score = 28.1 bits (61), Expect(2) = 6e-06 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = +3 Query: 150 RDVKKRSGSSWIS*MDIKKNATAWVKSRGSNIP*SINLHE 269 R++KK G+SW +DI+ + ++ S GSN P SI +++ Sbjct: 554 RNIKKEPGASW---LDIRNDIHVFL-SEGSNHPESIQIYK 589