BLASTX nr result
ID: Cnidium21_contig00036156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00036156 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB77434.1| S-RNase-binding protein [Petunia integrifolia sub... 67 2e-09 gb|AAF28357.2|AF223395_1 S-ribonuclease binding protein SBP1 [Pe... 67 2e-09 gb|ACN26598.1| unknown [Zea mays] gi|413956245|gb|AFW88894.1| pu... 66 3e-09 ref|NP_001148956.1| LOC100282576 [Zea mays] gi|195623616|gb|ACG3... 66 3e-09 ref|XP_003550333.1| PREDICTED: uncharacterized protein LOC100811... 65 6e-09 >gb|ABB77434.1| S-RNase-binding protein [Petunia integrifolia subsp. inflata] Length = 335 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 284 EVSMLLLPCKHLCVCKECESRLSHCPLCQSSK 189 EVSMLLLPCKHLC+CKECES+LS CPLCQS+K Sbjct: 296 EVSMLLLPCKHLCLCKECESKLSLCPLCQSTK 327 >gb|AAF28357.2|AF223395_1 S-ribonuclease binding protein SBP1 [Petunia x hybrida] Length = 332 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 284 EVSMLLLPCKHLCVCKECESRLSHCPLCQSSK 189 EVSMLLLPCKHLC+CKECES+LS CPLCQS+K Sbjct: 293 EVSMLLLPCKHLCLCKECESKLSLCPLCQSTK 324 >gb|ACN26598.1| unknown [Zea mays] gi|413956245|gb|AFW88894.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 329 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 284 EVSMLLLPCKHLCVCKECESRLSHCPLCQSSK 189 E SMLLLPC+HLC+CKECES+LS CPLCQSSK Sbjct: 289 EASMLLLPCRHLCLCKECESKLSFCPLCQSSK 320 >ref|NP_001148956.1| LOC100282576 [Zea mays] gi|195623616|gb|ACG33638.1| CONSTANS interacting protein 4 [Zea mays] Length = 329 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 284 EVSMLLLPCKHLCVCKECESRLSHCPLCQSSK 189 E SMLLLPC+HLC+CKECES+LS CPLCQSSK Sbjct: 289 EASMLLLPCRHLCLCKECESKLSFCPLCQSSK 320 >ref|XP_003550333.1| PREDICTED: uncharacterized protein LOC100811918 [Glycine max] Length = 342 Score = 65.1 bits (157), Expect = 6e-09 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -1 Query: 284 EVSMLLLPCKHLCVCKECESRLSHCPLCQSSK 189 EV+M+LLPCKHLC+CK+CES+LS CPLCQSSK Sbjct: 303 EVTMVLLPCKHLCLCKDCESKLSFCPLCQSSK 334