BLASTX nr result
ID: Cnidium21_contig00036123
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00036123 (905 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002327754.1| calcium dependent protein kinase 18 [Populus... 57 8e-06 >ref|XP_002327754.1| calcium dependent protein kinase 18 [Populus trichocarpa] gi|222836839|gb|EEE75232.1| calcium dependent protein kinase 18 [Populus trichocarpa] Length = 556 Score = 56.6 bits (135), Expect = 8e-06 Identities = 31/48 (64%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +1 Query: 577 HAGFRGSKDPLSEEADFDRKEKISLSEFQMLLRT-SMGTRNVNSIATH 717 H G RGS DPL EEAD D+ KISLSEF+ LLRT SM +RNV S + H Sbjct: 503 HTGLRGSIDPLLEEADIDKDGKISLSEFRRLLRTASMSSRNVPSPSGH 550