BLASTX nr result
ID: Cnidium21_contig00036115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00036115 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631195.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >ref|XP_003631195.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Vitis vinifera] Length = 142 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = -2 Query: 178 ISFLTRIKHTNSSFLPI--ISTIFLSSYFKKGQPRNAMKVFNWMTRPDCADDPDCRFYAI 5 ++ LTR+KH + + I+T+ +SSYFKK +P+ A KVFNWM+RPD P Y++ Sbjct: 1 MALLTRLKHNQFAHYSLRPITTLLISSYFKKRRPKEAFKVFNWMSRPDSHCTPHVAAYSL 60