BLASTX nr result
ID: Cnidium21_contig00036075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00036075 (1025 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD59558.1| ribosomal protein L5 [Triticum aestivum] 62 2e-07 ref|YP_005090465.1| ribosomal protein L5 (mitochondrion) [Millet... 62 3e-07 ref|YP_003875504.1| ribosomal protein L5 [Silene latifolia] gi|2... 62 3e-07 ref|YP_002000593.1| ribosomal protein L5 [Oryza sativa Japonica ... 62 3e-07 ref|YP_006280936.1| ribosomal protein L5 (mitochondrion) [Spirod... 61 4e-07 >emb|CAD59558.1| ribosomal protein L5 [Triticum aestivum] Length = 189 Score = 62.4 bits (150), Expect = 2e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 91 LMFPLHFHYEDVLRQDLLLKPNYANVMEVP 2 +MFPLHFHYEDVLRQDLLLK NYANVMEVP Sbjct: 1 MMFPLHFHYEDVLRQDLLLKLNYANVMEVP 30 >ref|YP_005090465.1| ribosomal protein L5 (mitochondrion) [Millettia pinnata] gi|357197328|gb|AET62925.1| ribosomal protein L5 (mitochondrion) [Millettia pinnata] Length = 186 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 88 MFPLHFHYEDVLRQDLLLKPNYANVMEVP 2 MFPLHFHYEDVLRQDLLLK NYANVMEVP Sbjct: 1 MFPLHFHYEDVLRQDLLLKLNYANVMEVP 29 >ref|YP_003875504.1| ribosomal protein L5 [Silene latifolia] gi|296040617|gb|ADG85276.1| ribosomal protein L5 [Silene latifolia] gi|301338034|gb|ADK73326.1| ribosomal protein L5 [Silene latifolia] Length = 184 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 88 MFPLHFHYEDVLRQDLLLKPNYANVMEVP 2 MFPLHFHYEDVLRQDLLLK NYANVMEVP Sbjct: 1 MFPLHFHYEDVLRQDLLLKLNYANVMEVP 29 >ref|YP_002000593.1| ribosomal protein L5 [Oryza sativa Japonica Group] gi|60498751|dbj|BAC19898.2| Ribosomal protein L5 [Oryza sativa Japonica Group] Length = 188 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 88 MFPLHFHYEDVLRQDLLLKPNYANVMEVP 2 MFPLHFHYEDVLRQDLLLK NYANVMEVP Sbjct: 1 MFPLHFHYEDVLRQDLLLKLNYANVMEVP 29 >ref|YP_006280936.1| ribosomal protein L5 (mitochondrion) [Spirodela polyrhiza] gi|385252637|gb|AFI54945.1| ribosomal protein L5 (mitochondrion) [Spirodela polyrhiza] Length = 184 Score = 61.2 bits (147), Expect = 4e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 88 MFPLHFHYEDVLRQDLLLKPNYANVMEVP 2 MFPLHFHYEDV RQDLLLKPN+ANVMEVP Sbjct: 1 MFPLHFHYEDVSRQDLLLKPNHANVMEVP 29