BLASTX nr result
ID: Cnidium21_contig00036053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00036053 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521646.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 >ref|XP_002521646.1| conserved hypothetical protein [Ricinus communis] gi|223539158|gb|EEF40753.1| conserved hypothetical protein [Ricinus communis] Length = 434 Score = 58.2 bits (139), Expect = 7e-07 Identities = 38/80 (47%), Positives = 49/80 (61%) Frame = +2 Query: 53 KFDDYVENNMYLDWNTKRAALDASPYVVALTSYTGPQRLFICSGTIVNSYGANGKFLGTI 232 KF + EN + LD TKRAAL AS VV+L SY+G +F SGT++ S G I Sbjct: 59 KFSRFFEN-LDLDIYTKRAALRASVSVVSLISYSGGDEIFQGSGTVIESDDTG----GII 113 Query: 233 LTSATLLRCPTTEDSVADDI 292 LTSA L+R P + +S+AD I Sbjct: 114 LTSADLIRSPLSGNSIADAI 133