BLASTX nr result
ID: Cnidium21_contig00035922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00035922 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_193234.4| Cysteine/Histidine-rich C1 domain family protei... 60 2e-07 emb|CAB46054.1| hypothetical protein [Arabidopsis thaliana] gi|7... 60 2e-07 ref|NP_199290.1| cysteine/histidine-rich C1 domain-containing pr... 57 1e-06 ref|NP_683552.2| cysteine/histidine-rich C1 domain-containing pr... 57 2e-06 ref|NP_001189860.1| cysteine/histidine-rich C1 domain-containing... 57 2e-06 >ref|NP_193234.4| Cysteine/Histidine-rich C1 domain family protein [Arabidopsis thaliana] gi|332658133|gb|AEE83533.1| Cysteine/Histidine-rich C1 domain family protein [Arabidopsis thaliana] Length = 545 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/71 (43%), Positives = 39/71 (54%) Frame = -3 Query: 233 ISSTNHIKHWTHEEHVLEELYERRNDDEIPLLCEGCVKPIRTDEGVSYYGCVPCKYFMHK 54 + + I H++HEEHVL L E D + + C GCV I D S Y CV C Y +HK Sbjct: 256 VINEKEIIHFSHEEHVLR-LDENYVTDNVNMRCRGCVLAINGD---SCYKCVECDYILHK 311 Query: 53 GCAELPREIEH 21 CA LPR+ H Sbjct: 312 ACASLPRKKRH 322 >emb|CAB46054.1| hypothetical protein [Arabidopsis thaliana] gi|7268244|emb|CAB78540.1| hypothetical protein [Arabidopsis thaliana] gi|66792700|gb|AAY56452.1| At4g14980 [Arabidopsis thaliana] gi|111074202|gb|ABH04474.1| At4g14980 [Arabidopsis thaliana] Length = 470 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/71 (43%), Positives = 39/71 (54%) Frame = -3 Query: 233 ISSTNHIKHWTHEEHVLEELYERRNDDEIPLLCEGCVKPIRTDEGVSYYGCVPCKYFMHK 54 + + I H++HEEHVL L E D + + C GCV I D S Y CV C Y +HK Sbjct: 181 VINEKEIIHFSHEEHVLR-LDENYVTDNVNMRCRGCVLAINGD---SCYKCVECDYILHK 236 Query: 53 GCAELPREIEH 21 CA LPR+ H Sbjct: 237 ACASLPRKKRH 247 >ref|NP_199290.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|2660673|gb|AAC79144.1| unknown protein [Arabidopsis thaliana] gi|9758381|dbj|BAB08830.1| CHP-rich zinc finger protein-like [Arabidopsis thaliana] gi|67633858|gb|AAY78853.1| DC1 domain-containing protein [Arabidopsis thaliana] gi|332007776|gb|AED95159.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 541 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/71 (40%), Positives = 40/71 (56%) Frame = -3 Query: 233 ISSTNHIKHWTHEEHVLEELYERRNDDEIPLLCEGCVKPIRTDEGVSYYGCVPCKYFMHK 54 I+ I H++HEEHVL +D++ + C GC+ PI D Y CV C + +HK Sbjct: 251 INEKGDIVHFSHEEHVLRLDVNYVHDNDT-MCCGGCILPINDDP---CYKCVECDFCLHK 306 Query: 53 GCAELPREIEH 21 GCA LPR+ H Sbjct: 307 GCASLPRKKAH 317 >ref|NP_683552.2| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|332641517|gb|AEE75038.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 708 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/70 (38%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = -3 Query: 227 STNHIKHWTHEEHVLE-ELYERRNDDEIPLLCEGCVKPIRTDEGVSYYGCVPCKYFMHKG 51 S + IKH++HE H+L+ E Y+R D E C+ C+ PI + + +Y C+ C +F+H+ Sbjct: 404 SNDMIKHFSHEHHLLKLEKYDRVRDAEKQ--CQACILPINSHD--FFYNCMECDFFLHEV 459 Query: 50 CAELPREIEH 21 CA L R+++H Sbjct: 460 CAGLLRKLDH 469 >ref|NP_001189860.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|332641518|gb|AEE75039.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 910 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/70 (38%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = -3 Query: 227 STNHIKHWTHEEHVLE-ELYERRNDDEIPLLCEGCVKPIRTDEGVSYYGCVPCKYFMHKG 51 S + IKH++HE H+L+ E Y+R D E C+ C+ PI + + +Y C+ C +F+H+ Sbjct: 404 SNDMIKHFSHEHHLLKLEKYDRVRDAEKQ--CQACILPINSHD--FFYNCMECDFFLHEV 459 Query: 50 CAELPREIEH 21 CA L R+++H Sbjct: 460 CAGLLRKLDH 469