BLASTX nr result
ID: Cnidium21_contig00035670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00035670 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521650.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_002521650.1| conserved hypothetical protein [Ricinus communis] gi|223539162|gb|EEF40757.1| conserved hypothetical protein [Ricinus communis] Length = 293 Score = 60.1 bits (144), Expect = 2e-07 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 7/116 (6%) Frame = +2 Query: 62 NIIKVRARMPNNGWVPLKQVLVKKS--WDIIIFQFRSDIKCEVGKFVSNGTLSEKQILLH 235 +II + AR N P + +V K WD+ + Q + C G+F ++G++ Q LLH Sbjct: 74 SIISIHARRLNENDFPFECEIVSKKPKWDLALLQVKGVSDCSFGRFAADGSIFAGQNLLH 133 Query: 236 MG-----LKSYHIARVCSPCVEDVNLPSWDYEVTCEKYKPSASETIPAYPIMGHVF 388 +G + S+ I + CV DV LP+ C+ Y+ +A P Y +MG ++ Sbjct: 134 VGHPANFVGSFLIGKAAFQCVNDVVLPTGTQ--ICQNYQSTALHNTPRYRVMGDIW 187