BLASTX nr result
ID: Cnidium21_contig00035599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00035599 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB43666.1| putative protein [Arabidopsis thaliana] gi|72698... 67 2e-09 ref|XP_002320803.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 ref|XP_002511876.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 ref|XP_002283101.1| PREDICTED: origin recognition complex subuni... 61 1e-07 emb|CBI15609.3| unnamed protein product [Vitis vinifera] 61 1e-07 >emb|CAB43666.1| putative protein [Arabidopsis thaliana] gi|7269890|emb|CAB79749.1| putative protein [Arabidopsis thaliana] Length = 554 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -2 Query: 158 TTSDSCAINLLRASEKSMEQKDIAQQELLMRGPGTFPLERLLAIF 24 T SDS LLRASEKSME+K+IA+QE +M+GPG+FPLERLLAIF Sbjct: 421 TVSDSSYCFLLRASEKSMEKKEIAEQEAVMKGPGSFPLERLLAIF 465 >ref|XP_002320803.1| predicted protein [Populus trichocarpa] gi|222861576|gb|EEE99118.1| predicted protein [Populus trichocarpa] Length = 536 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/34 (85%), Positives = 34/34 (100%) Frame = -2 Query: 125 RASEKSMEQKDIAQQELLMRGPGTFPLERLLAIF 24 +ASEKSMEQK++A+QELLM+GPGTFPLERLLAIF Sbjct: 417 KASEKSMEQKEVAEQELLMKGPGTFPLERLLAIF 450 >ref|XP_002511876.1| conserved hypothetical protein [Ricinus communis] gi|223549056|gb|EEF50545.1| conserved hypothetical protein [Ricinus communis] Length = 547 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -2 Query: 167 DNITTSDSCAINLLRASEKSMEQKDIAQQELLMRGPGTFPLERLLAIF 24 D+ SD+C +ASEKSMEQK+ A+QELLM+GPGTFPLERLLAI+ Sbjct: 402 DSTGGSDNCK-RKRKASEKSMEQKEAAEQELLMKGPGTFPLERLLAIY 448 >ref|XP_002283101.1| PREDICTED: origin recognition complex subunit 5-like [Vitis vinifera] Length = 541 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -2 Query: 125 RASEKSMEQKDIAQQELLMRGPGTFPLERLLAIF 24 ++SEKSMEQK+ A+QELLM+GPGTFPLERLLAIF Sbjct: 420 KSSEKSMEQKETAEQELLMKGPGTFPLERLLAIF 453 >emb|CBI15609.3| unnamed protein product [Vitis vinifera] Length = 524 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -2 Query: 125 RASEKSMEQKDIAQQELLMRGPGTFPLERLLAIF 24 ++SEKSMEQK+ A+QELLM+GPGTFPLERLLAIF Sbjct: 403 KSSEKSMEQKETAEQELLMKGPGTFPLERLLAIF 436