BLASTX nr result
ID: Cnidium21_contig00035552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00035552 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003618180.1| Phosphate/phosphoenolpyruvate translocator [... 73 2e-11 emb|CBI34895.3| unnamed protein product [Vitis vinifera] 73 3e-11 ref|XP_002276496.1| PREDICTED: phosphoenolpyruvate/phosphate tra... 73 3e-11 sp|P52178.1|TPT2_BRAOB RecName: Full=Triose phosphate/phosphate ... 72 5e-11 gb|ABK78670.1| plastid phosphoenolpyruvate/phosphate translocato... 72 5e-11 >ref|XP_003618180.1| Phosphate/phosphoenolpyruvate translocator [Medicago truncatula] gi|355493195|gb|AES74398.1| Phosphate/phosphoenolpyruvate translocator [Medicago truncatula] Length = 418 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = +1 Query: 1 VVIVASVVFFQTPVSPVNALGTSLALAGVFMYSRAKQMKPNPK 129 VVIV+SV+FFQTPVSP+NALGT++AL GVF+YSRAK++KP PK Sbjct: 372 VVIVSSVIFFQTPVSPINALGTAIALVGVFLYSRAKRIKPMPK 414 >emb|CBI34895.3| unnamed protein product [Vitis vinifera] Length = 606 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +1 Query: 1 VVIVASVVFFQTPVSPVNALGTSLALAGVFMYSRAKQMKPNPKIA 135 VVI++SV+FFQTP SP+N+LGT +AL GVF+YSRAK+MKP PK A Sbjct: 562 VVIISSVIFFQTPASPINSLGTGVALVGVFLYSRAKRMKPKPKAA 606 >ref|XP_002276496.1| PREDICTED: phosphoenolpyruvate/phosphate translocator 2, chloroplastic-like [Vitis vinifera] Length = 401 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +1 Query: 1 VVIVASVVFFQTPVSPVNALGTSLALAGVFMYSRAKQMKPNPKIA 135 VVI++SV+FFQTP SP+N+LGT +AL GVF+YSRAK+MKP PK A Sbjct: 357 VVIISSVIFFQTPASPINSLGTGVALVGVFLYSRAKRMKPKPKAA 401 >sp|P52178.1|TPT2_BRAOB RecName: Full=Triose phosphate/phosphate translocator, non-green plastid, chloroplastic; Short=CTPT; Flags: Precursor gi|1143713|gb|AAA84892.1| non-green plastid phosphate/triose-phosphate translocator precursor [Brassica oleracea var. botrytis] Length = 402 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = +1 Query: 1 VVIVASVVFFQTPVSPVNALGTSLALAGVFMYSRAKQMKPNPKIA 135 VVIV+SV+FF+TPVSPVNA GT +ALAGVF+YSR K++KP PK A Sbjct: 358 VVIVSSVIFFKTPVSPVNAFGTGIALAGVFLYSRVKRIKPKPKTA 402 >gb|ABK78670.1| plastid phosphoenolpyruvate/phosphate translocator [Brassica napus] gi|187940348|gb|ACD39395.1| plastid phosphoenolpyruvate/phosphate translocator [Brassica napus] Length = 407 Score = 72.0 bits (175), Expect = 5e-11 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = +1 Query: 1 VVIVASVVFFQTPVSPVNALGTSLALAGVFMYSRAKQMKPNPKIA 135 VVIV+SV+FF+TPVSPVNA GT +ALAGVF+YSR K++KP PK A Sbjct: 363 VVIVSSVIFFKTPVSPVNAFGTGIALAGVFLYSRVKRIKPKPKTA 407