BLASTX nr result
ID: Cnidium21_contig00035519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00035519 (369 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316281.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 ref|XP_002533154.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 tpg|DAA50216.1| TPA: putative XH domain family protein [Zea mays] 56 3e-06 ref|XP_003604222.1| hypothetical protein MTR_4g006760 [Medicago ... 56 3e-06 >ref|XP_002316281.1| predicted protein [Populus trichocarpa] gi|222865321|gb|EEF02452.1| predicted protein [Populus trichocarpa] Length = 721 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = +3 Query: 219 YSETCCQQLSDGKLEVKISGDVYRCPYCSHKKRKQQYGFKDLLQHASAIG 368 Y ++L DGKL VKIS + + CP+C KKR Q Y +KDLLQHAS +G Sbjct: 21 YENEAYEELKDGKLRVKISDETFACPFCPQKKR-QAYLYKDLLQHASGVG 69 Score = 57.0 bits (136), Expect = 2e-06 Identities = 22/44 (50%), Positives = 33/44 (75%) Frame = +3 Query: 237 QQLSDGKLEVKISGDVYRCPYCSHKKRKQQYGFKDLLQHASAIG 368 ++L +G +VKIS + + CPYC KKRK+ Y ++DLLQHA+ +G Sbjct: 136 EELKNGNHQVKISDETFTCPYCPTKKRKRDYAYQDLLQHATGVG 179 >ref|XP_002533154.1| conserved hypothetical protein [Ricinus communis] gi|223527049|gb|EEF29235.1| conserved hypothetical protein [Ricinus communis] Length = 640 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = +3 Query: 219 YSETCCQQLSDGKLEVKISGDVYRCPYCSHKKRKQQYGFKDLLQHASAIG 368 Y C ++L +G VKIS + + CPYC KKRK++Y ++DLLQHAS +G Sbjct: 23 YEAQCYEELKNGTHHVKISDETFTCPYCP-KKRKREYLYRDLLQHASGVG 71 >tpg|DAA50216.1| TPA: putative XH domain family protein [Zea mays] Length = 687 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/50 (56%), Positives = 33/50 (66%) Frame = +3 Query: 219 YSETCCQQLSDGKLEVKISGDVYRCPYCSHKKRKQQYGFKDLLQHASAIG 368 + E C QL GKL VK G+ +RCP+C KKR Q Y KDLLQHA+ IG Sbjct: 103 HKEEICAQLRAGKLNVK-RGEAFRCPFCPGKKR-QDYNLKDLLQHATGIG 150 >ref|XP_003604222.1| hypothetical protein MTR_4g006760 [Medicago truncatula] gi|355505277|gb|AES86419.1| hypothetical protein MTR_4g006760 [Medicago truncatula] Length = 657 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = +3 Query: 219 YSETCCQQLSDGKLEVKISGDVYRCPYCSHKKRKQQYGFKDLLQHASAIG 368 YSE ++L GK +VK + RCPYCS KK KQ++ +KDLLQHAS +G Sbjct: 50 YSEKPYEELRAGKYKVKNNNGTLRCPYCSGKK-KQEFKYKDLLQHASGVG 98