BLASTX nr result
ID: Cnidium21_contig00035480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00035480 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC49443.1| beta-carotene hydroxylase, partial [Arabidopsis t... 68 7e-10 ref|NP_194300.1| beta-carotene hydroxylase [Arabidopsis thaliana... 68 7e-10 gb|ADN29991.1| beta-carotene hydroxylase [Brassica napus] gi|307... 68 7e-10 ref|XP_002867597.1| beta-carotene hydroxylase [Arabidopsis lyrat... 68 7e-10 gb|ACS45170.1| beta-carotene hydroxylase [Brassica rapa subsp. p... 68 7e-10 >gb|AAC49443.1| beta-carotene hydroxylase, partial [Arabidopsis thaliana] Length = 294 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 227 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV 319 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV Sbjct: 200 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV 230 >ref|NP_194300.1| beta-carotene hydroxylase [Arabidopsis thaliana] gi|75266785|sp|Q9SZZ8.1|BCH1_ARATH RecName: Full=Beta-carotene 3-hydroxylase 1, chloroplastic; Short=AtB1; Flags: Precursor gi|9230270|gb|AAF85797.1|AF125576_1 beta-carotene hydroxylase [Arabidopsis thaliana] gi|9230272|gb|AAF85798.1|AF125577_1 beta-carotene hydroxylase [Arabidopsis thaliana] gi|13877915|gb|AAK44035.1|AF370220_1 putative beta-carotene hydroxylase [Arabidopsis thaliana] gi|4914462|emb|CAB43701.1| beta-carotene hydroxylase [Arabidopsis thaliana] gi|7269420|emb|CAB81380.1| beta-carotene hydroxylase [Arabidopsis thaliana] gi|21280903|gb|AAM44971.1| putative beta-carotene hydroxylase [Arabidopsis thaliana] gi|332659698|gb|AEE85098.1| beta-carotene hydroxylase [Arabidopsis thaliana] Length = 310 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 227 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV 319 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV Sbjct: 216 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV 246 >gb|ADN29991.1| beta-carotene hydroxylase [Brassica napus] gi|307095378|gb|ADN29992.1| beta-carotene hydroxylase [Brassica napus] Length = 300 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 227 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV 319 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV Sbjct: 212 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV 242 >ref|XP_002867597.1| beta-carotene hydroxylase [Arabidopsis lyrata subsp. lyrata] gi|297313433|gb|EFH43856.1| beta-carotene hydroxylase [Arabidopsis lyrata subsp. lyrata] Length = 305 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 227 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV 319 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV Sbjct: 213 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV 243 >gb|ACS45170.1| beta-carotene hydroxylase [Brassica rapa subsp. pekinensis] Length = 306 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 227 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV 319 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV Sbjct: 218 GLGITVFGIAYMFVHDGLVHKRFPVGPIADV 248