BLASTX nr result
ID: Cnidium21_contig00035400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00035400 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234545.1| auxin response factor 5 [Solanum lycopersicu... 65 6e-09 ref|XP_003634382.1| PREDICTED: auxin response factor 5-like isof... 62 4e-08 ref|XP_003634381.1| PREDICTED: auxin response factor 5-like isof... 62 4e-08 ref|XP_003550416.1| PREDICTED: auxin response factor 5-like [Gly... 62 4e-08 ref|XP_003544394.1| PREDICTED: auxin response factor 5-like [Gly... 62 4e-08 >ref|NP_001234545.1| auxin response factor 5 [Solanum lycopersicum] gi|300253180|gb|ADJ96592.1| auxin response factor 5 [Solanum lycopersicum] gi|310697420|gb|ADP06665.1| auxin response factor 5 [Solanum lycopersicum] Length = 930 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 407 DDPWEEFVGCVRSVRILSPSEVQQMGEEGMQ 315 DDPWEEFVGCVR +RILSP+EVQQMGEEGMQ Sbjct: 881 DDPWEEFVGCVRCIRILSPTEVQQMGEEGMQ 911 >ref|XP_003634382.1| PREDICTED: auxin response factor 5-like isoform 2 [Vitis vinifera] Length = 947 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DDPWEEFVGCVRSVRILSPSEVQQMGEEGMQ 315 DDPW+EFVGCVR +RILSPSEVQQM EEGMQ Sbjct: 901 DDPWKEFVGCVRCIRILSPSEVQQMSEEGMQ 931 >ref|XP_003634381.1| PREDICTED: auxin response factor 5-like isoform 1 [Vitis vinifera] Length = 925 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DDPWEEFVGCVRSVRILSPSEVQQMGEEGMQ 315 DDPW+EFVGCVR +RILSPSEVQQM EEGMQ Sbjct: 879 DDPWKEFVGCVRCIRILSPSEVQQMSEEGMQ 909 >ref|XP_003550416.1| PREDICTED: auxin response factor 5-like [Glycine max] Length = 934 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DDPWEEFVGCVRSVRILSPSEVQQMGEEGMQ 315 DDPWEEFVGCVR +RILSPSEVQQM EEGM+ Sbjct: 892 DDPWEEFVGCVRCIRILSPSEVQQMSEEGMK 922 >ref|XP_003544394.1| PREDICTED: auxin response factor 5-like [Glycine max] Length = 929 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 407 DDPWEEFVGCVRSVRILSPSEVQQMGEEGMQ 315 DDPWEEFVGCVR +RILSPSEVQQM EEGM+ Sbjct: 887 DDPWEEFVGCVRCIRILSPSEVQQMSEEGMK 917