BLASTX nr result
ID: Cnidium21_contig00035189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00035189 (981 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633970.1| PREDICTED: dynamin-related protein 5A [Vitis... 59 2e-06 ref|XP_002263342.1| PREDICTED: dynamin-related protein 5A isofor... 59 2e-06 emb|CAN71952.1| hypothetical protein VITISV_024310 [Vitis vinifera] 59 2e-06 ref|XP_003631401.1| PREDICTED: dynamin-related protein 5A [Vitis... 58 4e-06 ref|XP_002268573.1| PREDICTED: dynamin-related protein 5A isofor... 58 4e-06 >ref|XP_003633970.1| PREDICTED: dynamin-related protein 5A [Vitis vinifera] Length = 608 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 3/54 (5%) Frame = -3 Query: 358 IMEEISQKLQFPWIDVVN*CEANINESFDMVAARRKEREREYLAKS---KHLLH 206 I+E S KLQFPWI VVN +A+IN+S DM+AARR REREY + S KHL H Sbjct: 229 ILEGKSYKLQFPWIGVVNRSQADINKSVDMIAARR--REREYFSNSPEYKHLSH 280 >ref|XP_002263342.1| PREDICTED: dynamin-related protein 5A isoform 1 [Vitis vinifera] gi|297745468|emb|CBI40548.3| unnamed protein product [Vitis vinifera] Length = 614 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 3/54 (5%) Frame = -3 Query: 358 IMEEISQKLQFPWIDVVN*CEANINESFDMVAARRKEREREYLAKS---KHLLH 206 I+E S KLQFPWI VVN +A+IN+S DM+AARR REREY + S KHL H Sbjct: 229 ILEGKSYKLQFPWIGVVNRSQADINKSVDMIAARR--REREYFSNSPEYKHLSH 280 >emb|CAN71952.1| hypothetical protein VITISV_024310 [Vitis vinifera] Length = 605 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 3/54 (5%) Frame = -3 Query: 358 IMEEISQKLQFPWIDVVN*CEANINESFDMVAARRKEREREYLAKS---KHLLH 206 I+E S KLQFPWI VVN +A+IN+S DM+AARR REREY + S KHL H Sbjct: 229 ILEGKSYKLQFPWIGVVNRSQADINKSVDMIAARR--REREYFSNSPEYKHLSH 280 >ref|XP_003631401.1| PREDICTED: dynamin-related protein 5A [Vitis vinifera] Length = 603 Score = 57.8 bits (138), Expect = 4e-06 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 3/54 (5%) Frame = -3 Query: 358 IMEEISQKLQFPWIDVVN*CEANINESFDMVAARRKEREREYLAKS---KHLLH 206 I+E S +LQFPWI VVN +A+IN+S DM+AARR REREY A + KHL H Sbjct: 224 ILEGKSYRLQFPWIGVVNRSQADINKSVDMIAARR--REREYFANTPEYKHLAH 275 >ref|XP_002268573.1| PREDICTED: dynamin-related protein 5A isoform 2 [Vitis vinifera] Length = 592 Score = 57.8 bits (138), Expect = 4e-06 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 3/54 (5%) Frame = -3 Query: 358 IMEEISQKLQFPWIDVVN*CEANINESFDMVAARRKEREREYLAKS---KHLLH 206 I+E S +LQFPWI VVN +A+IN+S DM+AARR REREY A + KHL H Sbjct: 207 ILEGKSYRLQFPWIGVVNRSQADINKSVDMIAARR--REREYFANTPEYKHLAH 258