BLASTX nr result
ID: Cnidium21_contig00035094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00035094 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280827.1| PREDICTED: UPF0160 protein MYG1, mitochondri... 160 1e-37 emb|CBI34574.3| unnamed protein product [Vitis vinifera] 160 1e-37 ref|XP_002518897.1| Protein MYG1, putative [Ricinus communis] gi... 159 2e-37 ref|XP_003570120.1| PREDICTED: UPF0160 protein MYG1, mitochondri... 157 7e-37 ref|NP_199012.2| Metal-dependent protein hydrolase [Arabidopsis ... 156 1e-36 >ref|XP_002280827.1| PREDICTED: UPF0160 protein MYG1, mitochondrial-like [Vitis vinifera] Length = 361 Score = 160 bits (405), Expect = 1e-37 Identities = 72/87 (82%), Positives = 82/87 (94%) Frame = -2 Query: 262 KSWLPARSIVMECLAARQTVDPSGEIMVLDRFCPWKLHLFELEQEMKIEPSIKYVLYQDE 83 KSWLPARSIVMECLAAR +DPSGEIMVL+RFCPWKLHLFELE+EMKI+P IKYVLYQD+ Sbjct: 230 KSWLPARSIVMECLAARMDIDPSGEIMVLNRFCPWKLHLFELEEEMKIDPPIKYVLYQDD 289 Query: 82 RAKQWRVQAVSLAPDRFESRKALPAQW 2 R+K WRVQAV++APD+FESRK LP+QW Sbjct: 290 RSKHWRVQAVAVAPDKFESRKPLPSQW 316 >emb|CBI34574.3| unnamed protein product [Vitis vinifera] Length = 338 Score = 160 bits (405), Expect = 1e-37 Identities = 72/87 (82%), Positives = 82/87 (94%) Frame = -2 Query: 262 KSWLPARSIVMECLAARQTVDPSGEIMVLDRFCPWKLHLFELEQEMKIEPSIKYVLYQDE 83 KSWLPARSIVMECLAAR +DPSGEIMVL+RFCPWKLHLFELE+EMKI+P IKYVLYQD+ Sbjct: 207 KSWLPARSIVMECLAARMDIDPSGEIMVLNRFCPWKLHLFELEEEMKIDPPIKYVLYQDD 266 Query: 82 RAKQWRVQAVSLAPDRFESRKALPAQW 2 R+K WRVQAV++APD+FESRK LP+QW Sbjct: 267 RSKHWRVQAVAVAPDKFESRKPLPSQW 293 >ref|XP_002518897.1| Protein MYG1, putative [Ricinus communis] gi|223541884|gb|EEF43430.1| Protein MYG1, putative [Ricinus communis] Length = 373 Score = 159 bits (403), Expect = 2e-37 Identities = 73/87 (83%), Positives = 81/87 (93%) Frame = -2 Query: 262 KSWLPARSIVMECLAARQTVDPSGEIMVLDRFCPWKLHLFELEQEMKIEPSIKYVLYQDE 83 KSWLPARSIVMECL AR VDPSGEIMVL FCPWKLHLFE+E+E+KIEPSIKYVLYQD+ Sbjct: 242 KSWLPARSIVMECLEARSDVDPSGEIMVLATFCPWKLHLFEIEEELKIEPSIKYVLYQDD 301 Query: 82 RAKQWRVQAVSLAPDRFESRKALPAQW 2 R+K WRVQAV++APDRFESR+ALPAQW Sbjct: 302 RSKHWRVQAVAVAPDRFESRRALPAQW 328 >ref|XP_003570120.1| PREDICTED: UPF0160 protein MYG1, mitochondrial-like [Brachypodium distachyon] Length = 385 Score = 157 bits (398), Expect = 7e-37 Identities = 73/87 (83%), Positives = 79/87 (90%) Frame = -2 Query: 262 KSWLPARSIVMECLAARQTVDPSGEIMVLDRFCPWKLHLFELEQEMKIEPSIKYVLYQDE 83 KSWLPARSIVMECL +R VDPSGEIMVLDRFCPWKLHLFELEQE+K +P KYVLYQDE Sbjct: 254 KSWLPARSIVMECLLSRGNVDPSGEIMVLDRFCPWKLHLFELEQELKTDPLTKYVLYQDE 313 Query: 82 RAKQWRVQAVSLAPDRFESRKALPAQW 2 R+K WRVQAVS+APDRFESRKALP +W Sbjct: 314 RSKTWRVQAVSVAPDRFESRKALPERW 340 >ref|NP_199012.2| Metal-dependent protein hydrolase [Arabidopsis thaliana] gi|332007365|gb|AED94748.1| Metal-dependent protein hydrolase [Arabidopsis thaliana] Length = 373 Score = 156 bits (395), Expect = 1e-36 Identities = 71/87 (81%), Positives = 79/87 (90%) Frame = -2 Query: 262 KSWLPARSIVMECLAARQTVDPSGEIMVLDRFCPWKLHLFELEQEMKIEPSIKYVLYQDE 83 +SWLPARSIVM+CL R DPSGEIM+LDRFCPWKLHLFELEQEMKIEP IKYV+YQDE Sbjct: 242 RSWLPARSIVMQCLEERFKTDPSGEIMILDRFCPWKLHLFELEQEMKIEPLIKYVIYQDE 301 Query: 82 RAKQWRVQAVSLAPDRFESRKALPAQW 2 RAKQWRVQAV++APDRFE+RK LP +W Sbjct: 302 RAKQWRVQAVAVAPDRFENRKPLPEKW 328