BLASTX nr result
ID: Cnidium21_contig00034948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034948 (551 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535704.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-07 >ref|XP_003535704.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, mitochondrial-like [Glycine max] Length = 507 Score = 57.4 bits (137), Expect(2) = 6e-07 Identities = 37/103 (35%), Positives = 55/103 (53%), Gaps = 5/103 (4%) Frame = -1 Query: 386 PPPPISMKELFFKTASDVQSLILTQSDEYNSTFVHDTYKY--LIVSLRSIKQFKMVWVLV 213 P P + ++ L + + V +L + E S F H T + LI +L I+QFKM+W LV Sbjct: 84 PSPELVLEVLNKLSNAGVLALSFFRWAEKQSEFKHTTEAFHALIEALGKIRQFKMIWTLV 143 Query: 212 NDMKQKRGFDQRHFTW---RYTRAMKVKEALKRLRGWKYLNLR 93 NDMKQ++ F+ RY RA K KEA+K ++ L+ Sbjct: 144 NDMKQRKLLTSDTFSLVARRYARARKAKEAIKTFEKMEHYGLK 186 Score = 21.2 bits (43), Expect(2) = 6e-07 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 58 LYKYGNVEIAHQLFDKWK 5 L K +VE AH++FDK + Sbjct: 199 LCKSKSVEEAHEVFDKMR 216