BLASTX nr result
ID: Cnidium21_contig00034829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034829 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW62556.1| hypothetical protein ZEAMMB73_728251 [Zea mays] 60 2e-07 ref|YP_588418.1| hypothetical protein ZeamMp173 [Zea mays subsp.... 60 2e-07 >gb|AFW62556.1| hypothetical protein ZEAMMB73_728251 [Zea mays] Length = 137 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -2 Query: 106 VSFPFRNWLEMGATIPARIQPDSIDHVPFLTVVHC 2 +S PF NWL MGATIPARIQP SIDHVPF TVV C Sbjct: 1 MSEPFMNWLGMGATIPARIQPGSIDHVPFPTVVPC 35 >ref|YP_588418.1| hypothetical protein ZeamMp173 [Zea mays subsp. mays] gi|40795085|gb|AAR91129.1| hypothetical protein (mitochondrion) [Zea mays] Length = 117 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -2 Query: 106 VSFPFRNWLEMGATIPARIQPDSIDHVPFLTVVHC 2 +S PF NWL MGATIPARIQP SIDHVPF TVV C Sbjct: 1 MSEPFMNWLGMGATIPARIQPGSIDHVPFPTVVPC 35