BLASTX nr result
ID: Cnidium21_contig00034794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034794 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004140074.1| PREDICTED: sorting and assembly machinery co... 60 2e-07 ref|XP_003552272.1| PREDICTED: sorting and assembly machinery co... 59 5e-07 ref|XP_002528327.1| sorting and assembly machinery (sam50) prote... 59 5e-07 ref|XP_002312173.1| predicted protein [Populus trichocarpa] gi|1... 59 5e-07 ref|XP_003538477.1| PREDICTED: sorting and assembly machinery co... 57 1e-06 >ref|XP_004140074.1| PREDICTED: sorting and assembly machinery component 50 homolog [Cucumis sativus] gi|449490420|ref|XP_004158600.1| PREDICTED: sorting and assembly machinery component 50 homolog [Cucumis sativus] Length = 536 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = +2 Query: 242 KLRAQKAKMENLFHRISNETVPLRVHDVLIKGNNRTKESLIEAE 373 +L AQ++K+ENL R+ E V LRVHD+LIKGN +TK+SLIEAE Sbjct: 61 RLLAQRSKLENLVERMRKEKVRLRVHDILIKGNTKTKDSLIEAE 104 >ref|XP_003552272.1| PREDICTED: sorting and assembly machinery component 50 homolog [Glycine max] Length = 530 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = +2 Query: 242 KLRAQKAKMENLFHRISNETVPLRVHDVLIKGNNRTKESLIEAE 373 +LR Q++K+E L R+++E VP+RVHDVLI+GN +TKE +IEAE Sbjct: 55 RLREQRSKLETLSRRLASELVPIRVHDVLIRGNTKTKEWVIEAE 98 >ref|XP_002528327.1| sorting and assembly machinery (sam50) protein, putative [Ricinus communis] gi|223532282|gb|EEF34085.1| sorting and assembly machinery (sam50) protein, putative [Ricinus communis] Length = 518 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +2 Query: 248 RAQKAKMENLFHRISNETVPLRVHDVLIKGNNRTKESLIEAE 373 R ++ K+ENL R+ ETVPLRVHDV+IKGN +TK+S++E+E Sbjct: 46 RVEREKVENLIRRMQTETVPLRVHDVIIKGNVKTKDSILESE 87 >ref|XP_002312173.1| predicted protein [Populus trichocarpa] gi|118486263|gb|ABK94973.1| unknown [Populus trichocarpa] gi|222851993|gb|EEE89540.1| predicted protein [Populus trichocarpa] Length = 519 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/47 (59%), Positives = 38/47 (80%), Gaps = 4/47 (8%) Frame = +2 Query: 245 LRAQKAKM----ENLFHRISNETVPLRVHDVLIKGNNRTKESLIEAE 373 L +QKAK+ +N F RI +E+VP+RVHDV+IKGN +TK++LIEAE Sbjct: 42 LESQKAKLRNRFQNFFRRIQHESVPIRVHDVVIKGNTKTKDTLIEAE 88 >ref|XP_003538477.1| PREDICTED: sorting and assembly machinery component 50 homolog [Glycine max] Length = 528 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +2 Query: 242 KLRAQKAKMENLFHRISNETVPLRVHDVLIKGNNRTKESLIEAE 373 +LR Q++K+E L R+++E VP+RVHDVLI+GN +TK LIEAE Sbjct: 53 RLREQRSKLETLSRRLASELVPIRVHDVLIRGNTKTKAWLIEAE 96