BLASTX nr result
ID: Cnidium21_contig00034771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034771 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281132.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|NP_179197.1| pentatricopeptide repeat-containing protein [Ar... 91 1e-16 emb|CBI32533.3| unnamed protein product [Vitis vinifera] 90 2e-16 ref|XP_003537906.1| PREDICTED: pentatricopeptide repeat-containi... 84 9e-15 ref|XP_004161634.1| PREDICTED: pentatricopeptide repeat-containi... 82 3e-14 >ref|XP_002281132.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980-like [Vitis vinifera] Length = 492 Score = 100 bits (248), Expect = 2e-19 Identities = 45/70 (64%), Positives = 59/70 (84%) Frame = -3 Query: 212 KTVITTAVTVLKHHRSKSRWTHLRSLFPDGFTPTQVSQITLQLRNNPHLALNYFNFTVQH 33 KT+I+TAV++L+H RSKSRW+HL+SLFP GFTPT+ SQI LQ++NNPHLAL++F + Sbjct: 34 KTLISTAVSILRHQRSKSRWSHLQSLFPKGFTPTEASQIVLQIKNNPHLALSFFLWCHHK 93 Query: 32 SLCCHSLDSY 3 SLC H+L SY Sbjct: 94 SLCNHTLLSY 103 >ref|NP_179197.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75267579|sp|Q9XIM8.1|PP155_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g15980 gi|5306237|gb|AAD41970.1| hypothetical protein [Arabidopsis thaliana] gi|330251359|gb|AEC06453.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 498 Score = 90.5 bits (223), Expect = 1e-16 Identities = 42/67 (62%), Positives = 53/67 (79%) Frame = -3 Query: 206 VITTAVTVLKHHRSKSRWTHLRSLFPDGFTPTQVSQITLQLRNNPHLALNYFNFTVQHSL 27 +I+ AV++L HHRSKSRW+ LRSL P GFTP+Q S+ITL LRNNPHL+L +F FT ++SL Sbjct: 41 LISDAVSILTHHRSKSRWSTLRSLQPSGFTPSQFSEITLCLRNNPHLSLRFFLFTRRYSL 100 Query: 26 CCHSLDS 6 C H S Sbjct: 101 CSHDTHS 107 >emb|CBI32533.3| unnamed protein product [Vitis vinifera] Length = 299 Score = 89.7 bits (221), Expect = 2e-16 Identities = 38/54 (70%), Positives = 50/54 (92%) Frame = -3 Query: 212 KTVITTAVTVLKHHRSKSRWTHLRSLFPDGFTPTQVSQITLQLRNNPHLALNYF 51 KT+I+TAV++L+H RSKSRW+HL+SLFP GFTPT+ SQI LQ++NNPHLAL++F Sbjct: 34 KTLISTAVSILRHQRSKSRWSHLQSLFPKGFTPTEASQIVLQIKNNPHLALSFF 87 >ref|XP_003537906.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980-like [Glycine max] Length = 487 Score = 84.3 bits (207), Expect = 9e-15 Identities = 37/70 (52%), Positives = 53/70 (75%) Frame = -3 Query: 212 KTVITTAVTVLKHHRSKSRWTHLRSLFPDGFTPTQVSQITLQLRNNPHLALNYFNFTVQH 33 ++++T AV++L HHRSKSRW++LRS P+G TP + S+ITL ++N P LAL +F +T Sbjct: 32 QSLVTDAVSILTHHRSKSRWSNLRSACPNGITPAEFSEITLHIKNKPQLALRFFLWTKSK 91 Query: 32 SLCCHSLDSY 3 SLC H+L SY Sbjct: 92 SLCNHNLASY 101 >ref|XP_004161634.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15980-like [Cucumis sativus] Length = 499 Score = 82.4 bits (202), Expect = 3e-14 Identities = 40/70 (57%), Positives = 49/70 (70%) Frame = -3 Query: 212 KTVITTAVTVLKHHRSKSRWTHLRSLFPDGFTPTQVSQITLQLRNNPHLALNYFNFTVQH 33 K I+T V+VL H RSKSRW L SL P+GF P + S I LQ++NNPHLAL +F +T Sbjct: 40 KPSISTVVSVLTHQRSKSRWRFLNSLCPNGFDPGEFSDILLQIKNNPHLALRFFLWTQNK 99 Query: 32 SLCCHSLDSY 3 SLC H+L SY Sbjct: 100 SLCNHNLISY 109