BLASTX nr result
ID: Cnidium21_contig00034748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034748 (378 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518871.1| conserved hypothetical protein [Ricinus comm... 84 9e-15 >ref|XP_002518871.1| conserved hypothetical protein [Ricinus communis] gi|223541858|gb|EEF43404.1| conserved hypothetical protein [Ricinus communis] Length = 668 Score = 84.3 bits (207), Expect = 9e-15 Identities = 41/102 (40%), Positives = 58/102 (56%), Gaps = 10/102 (9%) Frame = +3 Query: 102 NHTLPDSWFWLLDNKGCFTVKSCYRNLQGEVQCLEASFWKRLWSLQLPGKV--------S 257 N + DSW+WL D+KG + VK+CYR LQG++ E SFW + W L++P KV S Sbjct: 390 NRNVEDSWYWLFDDKGNYLVKNCYRLLQGDLGRPETSFWNKFWKLKIPTKVRNLMWKICS 449 Query: 258 KCFTYSSG--TYWVNMCKPACSWCHTQCEDAVHVLFDCSFAK 377 C + +V++ P C WC+ + E HVLF CS A+ Sbjct: 450 NCIRTAMNLRMRYVDL-DPLCKWCNREPETLFHVLFGCSMAR 490