BLASTX nr result
ID: Cnidium21_contig00034731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034731 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF52855.1| repressor of silencing 1 [Nicotiana tabacum] 73 2e-11 >dbj|BAF52855.1| repressor of silencing 1 [Nicotiana tabacum] Length = 1796 Score = 73.2 bits (178), Expect = 2e-11 Identities = 39/87 (44%), Positives = 52/87 (59%) Frame = +1 Query: 4 DLYSTNIIGAHHNSVQAYPAMFPVDQDIIDGIPGMHFPTIYKKKRTEKCQNLIDQTTEYS 183 +LYSTN++GA+ NS+QAY A+ P ++ GMHFPTIYKKKRTEK + Sbjct: 494 ELYSTNVMGAYFNSMQAYQAILPANEPYAHSTQGMHFPTIYKKKRTEK---------GHP 544 Query: 184 PKANWGHAFTSERNYMSFAAQCTKPLS 264 ++ FT E NY+S +QC LS Sbjct: 545 TATSYAKPFTCETNYLSL-SQCNIGLS 570