BLASTX nr result
ID: Cnidium21_contig00034699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034699 (507 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523787.1| poly [ADP-ribose] polymerase, putative [Rici... 89 4e-16 ref|NP_197639.2| NAD+ ADP-ribosyltransferases;NAD+ ADP-ribosyltr... 89 5e-16 dbj|BAB09119.1| seed maturation protein PM38 protein [Arabidopsi... 89 5e-16 ref|XP_002872003.1| poly polymerase 3 (PARP-3) ADP-ribosyltransf... 89 5e-16 dbj|BAC42749.1| unknown protein [Arabidopsis thaliana] 89 5e-16 >ref|XP_002523787.1| poly [ADP-ribose] polymerase, putative [Ricinus communis] gi|223536875|gb|EEF38513.1| poly [ADP-ribose] polymerase, putative [Ricinus communis] Length = 815 Score = 89.0 bits (219), Expect = 4e-16 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = -2 Query: 506 DDIKVPCGRLIPSEHKDSVLEYNEYAVYDPQQVSIRFLVKVKFEEQDVVYEEASP 342 DDIKVPCGRL+PSE+KD LEYNEYAVYDP+Q SIRFLV +K+EE+D V + A P Sbjct: 761 DDIKVPCGRLMPSENKDGPLEYNEYAVYDPKQTSIRFLVGIKYEEKDAVMDTAEP 815 >ref|NP_197639.2| NAD+ ADP-ribosyltransferases;NAD+ ADP-ribosyltransferase [Arabidopsis thaliana] gi|374095437|sp|Q9FK91.2|PARP3_ARATH RecName: Full=Poly [ADP-ribose] polymerase 3; Short=PARP-3; AltName: Full=NAD(+) ADP-ribosyltransferase 3; Short=ADPRT-3; AltName: Full=Poly[ADP-ribose] synthase 3 gi|332005648|gb|AED93031.1| NAD+ ADP-ribosyltransferases;NAD+ ADP-ribosyltransferase [Arabidopsis thaliana] Length = 814 Score = 88.6 bits (218), Expect = 5e-16 Identities = 40/55 (72%), Positives = 46/55 (83%) Frame = -2 Query: 506 DDIKVPCGRLIPSEHKDSVLEYNEYAVYDPQQVSIRFLVKVKFEEQDVVYEEASP 342 DDIKVPCGRL+PSEHKDS LEYNEYAVYDP+Q SIRFLV+VK+EE+ + P Sbjct: 759 DDIKVPCGRLVPSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIVDVEP 813 >dbj|BAB09119.1| seed maturation protein PM38 protein [Arabidopsis thaliana] Length = 815 Score = 88.6 bits (218), Expect = 5e-16 Identities = 40/55 (72%), Positives = 46/55 (83%) Frame = -2 Query: 506 DDIKVPCGRLIPSEHKDSVLEYNEYAVYDPQQVSIRFLVKVKFEEQDVVYEEASP 342 DDIKVPCGRL+PSEHKDS LEYNEYAVYDP+Q SIRFLV+VK+EE+ + P Sbjct: 760 DDIKVPCGRLVPSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIVDVEP 814 >ref|XP_002872003.1| poly polymerase 3 (PARP-3) ADP-ribosyltransferase 3 [Arabidopsis lyrata subsp. lyrata] gi|297317840|gb|EFH48262.1| poly polymerase 3 (PARP-3) ADP-ribosyltransferase 3 [Arabidopsis lyrata subsp. lyrata] Length = 815 Score = 88.6 bits (218), Expect = 5e-16 Identities = 40/55 (72%), Positives = 46/55 (83%) Frame = -2 Query: 506 DDIKVPCGRLIPSEHKDSVLEYNEYAVYDPQQVSIRFLVKVKFEEQDVVYEEASP 342 DDIKVPCGRL+PSEHKDS LEYNEYAVYDP+Q SIRFLV+VK+EE+ + P Sbjct: 760 DDIKVPCGRLVPSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIVDVEP 814 >dbj|BAC42749.1| unknown protein [Arabidopsis thaliana] Length = 388 Score = 88.6 bits (218), Expect = 5e-16 Identities = 40/55 (72%), Positives = 46/55 (83%) Frame = -2 Query: 506 DDIKVPCGRLIPSEHKDSVLEYNEYAVYDPQQVSIRFLVKVKFEEQDVVYEEASP 342 DDIKVPCGRL+PSEHKDS LEYNEYAVYDP+Q SIRFLV+VK+EE+ + P Sbjct: 333 DDIKVPCGRLVPSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEKGTEIVDVEP 387