BLASTX nr result
ID: Cnidium21_contig00034696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034696 (630 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68669.1| hypothetical protein VITISV_039388 [Vitis vinifera] 57 3e-06 ref|XP_002532607.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >emb|CAN68669.1| hypothetical protein VITISV_039388 [Vitis vinifera] Length = 1360 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/75 (33%), Positives = 40/75 (53%) Frame = -3 Query: 232 PNFDGDNPRGWIIKARNYFKFKSKLDADMIRLAGLHFIGRASTWYKWFYENKNEQVEWKK 53 P F+GD+P GWI KA YF F + ++LA H G A W++W + + + W + Sbjct: 88 PKFNGDDPTGWIYKAEQYFDFMNITPGQQVQLASFHLEGIALQWHRWLTKFRG-PLTWDE 146 Query: 52 FLHDLLLRFDDSEVD 8 F + LRF ++ + Sbjct: 147 FTKAVQLRFGPTDYE 161 >ref|XP_002532607.1| conserved hypothetical protein [Ricinus communis] gi|223527663|gb|EEF29773.1| conserved hypothetical protein [Ricinus communis] Length = 140 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 3/71 (4%) Frame = -3 Query: 232 PNFDGDNPRGWIIKARNYFKFKSKLDADMIRLAGLHFIGRASTWYKWF---YENKNEQVE 62 P F GD+P W + YF F+ ++ + LA HF G A+ W++W Y+N+ + V Sbjct: 12 PKFQGDDPTVWHTRVEQYFDFQMTTESKKVPLASYHFEGEANEWWQWLNRAYKNEGKVVT 71 Query: 61 WKKFLHDLLLR 29 W+ + +L R Sbjct: 72 WEALVEELWAR 82