BLASTX nr result
ID: Cnidium21_contig00034683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034683 (480 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522536.1| hypothetical protein RCOM_1013810 [Ricinus c... 62 5e-08 >ref|XP_002522536.1| hypothetical protein RCOM_1013810 [Ricinus communis] gi|223538227|gb|EEF39836.1| hypothetical protein RCOM_1013810 [Ricinus communis] Length = 807 Score = 62.0 bits (149), Expect = 5e-08 Identities = 36/95 (37%), Positives = 54/95 (56%), Gaps = 3/95 (3%) Frame = +1 Query: 121 QESSANLVMLKPPKRLFLTPGGSRNFRESSIKLVDME---NFPDGNTDKVLNNSKSSCKH 291 + S+ NL L P KRL +P SRN +E+S V+ E P+ + VL N S Sbjct: 662 EASNENLQQLNPRKRLSQSPSESRNLKETSESTVEEEVRAATPESDPINVLRNHPHSGLE 721 Query: 292 FPQKVDMKEQETPL*IDNDTNIKNADACAKELDNV 396 PQ++ M+EQ L ++ND N+ A+A AKEL+++ Sbjct: 722 LPQQLSMEEQNISLAMENDGNVAKAEAYAKELEDI 756