BLASTX nr result
ID: Cnidium21_contig00034653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034653 (462 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310362.1| chromatin remodeling complex subunit [Populu... 55 8e-06 >ref|XP_002310362.1| chromatin remodeling complex subunit [Populus trichocarpa] gi|222853265|gb|EEE90812.1| chromatin remodeling complex subunit [Populus trichocarpa] Length = 923 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +3 Query: 294 NMLLMLLRLWQACDHPLLLKGFTSESVGGYSSQMATYISR 413 N+LLMLLRL QACDHPLL+KGF SESV S++MA + R Sbjct: 588 NILLMLLRLRQACDHPLLVKGFNSESVEKDSAEMANQLPR 627