BLASTX nr result
ID: Cnidium21_contig00034541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034541 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527918.1| alanine aminotransferase, putative [Ricinus ... 63 3e-08 ref|XP_002273994.1| PREDICTED: alanine aminotransferase 2 isofor... 62 5e-08 gb|AAZ43369.1| AlaT1 [Vitis vinifera] 60 1e-07 ref|XP_003635112.1| PREDICTED: alanine aminotransferase 2 isofor... 60 1e-07 ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransf... 60 2e-07 >ref|XP_002527918.1| alanine aminotransferase, putative [Ricinus communis] gi|223532693|gb|EEF34475.1| alanine aminotransferase, putative [Ricinus communis] Length = 452 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 346 AEEDMPGIMASFKKFNDQFMEQYEEYRGYSRM 251 AEEDMP IMASFKKFND+FME+YE++RGYSRM Sbjct: 421 AEEDMPAIMASFKKFNDEFMEEYEDHRGYSRM 452 >ref|XP_002273994.1| PREDICTED: alanine aminotransferase 2 isoform 1 [Vitis vinifera] gi|296083415|emb|CBI23368.3| unnamed protein product [Vitis vinifera] Length = 481 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 346 AEEDMPGIMASFKKFNDQFMEQYEEYRGYSRM 251 AEEDMP IM SFKKFND+FMEQYE++RGYSRM Sbjct: 450 AEEDMPAIMESFKKFNDEFMEQYEDHRGYSRM 481 >gb|AAZ43369.1| AlaT1 [Vitis vinifera] Length = 484 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 346 AEEDMPGIMASFKKFNDQFMEQYEEYRGYSRM 251 AEE+MP IM SFKKFND+FMEQYE++RGYSRM Sbjct: 450 AEEEMPAIMESFKKFNDEFMEQYEDHRGYSRM 481 >ref|XP_003635112.1| PREDICTED: alanine aminotransferase 2 isoform 2 [Vitis vinifera] Length = 487 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 346 AEEDMPGIMASFKKFNDQFMEQYEEYRGYSRM 251 AEEDMP IM SFKKFND+FMEQYE++RGYSR+ Sbjct: 450 AEEDMPAIMESFKKFNDEFMEQYEDHRGYSRI 481 >ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis sativus] Length = 460 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 346 AEEDMPGIMASFKKFNDQFMEQYEEYRGYSRM 251 AEEDMP IM SFKKFND FME+YE++RGYSRM Sbjct: 429 AEEDMPEIMTSFKKFNDSFMEEYEDHRGYSRM 460