BLASTX nr result
ID: Cnidium21_contig00034388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034388 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534135.1| Purple acid phosphatase precursor, putative ... 79 5e-13 ref|NP_564619.1| purple acid phosphatase 5 [Arabidopsis thaliana... 76 3e-12 ref|XP_002886149.1| ATPAP11/PAP11 [Arabidopsis lyrata subsp. lyr... 76 3e-12 ref|NP_179405.1| purple acid phosphatase 11 [Arabidopsis thalian... 76 3e-12 ref|NP_190198.1| purple acid phosphatase 19 [Arabidopsis thalian... 76 3e-12 >ref|XP_002534135.1| Purple acid phosphatase precursor, putative [Ricinus communis] gi|223525807|gb|EEF28252.1| Purple acid phosphatase precursor, putative [Ricinus communis] Length = 461 Score = 78.6 bits (192), Expect = 5e-13 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -1 Query: 277 YEPLYNSNNYHCMEGESMRVMLEPWFVQNKVDLVFAGHVHS 155 + P YNSN+YH MEGESMRVM EPWFV+NKVDLVFAGHVHS Sbjct: 309 HSPWYNSNSYHYMEGESMRVMFEPWFVENKVDLVFAGHVHS 349 >ref|NP_564619.1| purple acid phosphatase 5 [Arabidopsis thaliana] gi|75262216|sp|Q9C927.1|PPA5_ARATH RecName: Full=Purple acid phosphatase 5; Flags: Precursor gi|12324639|gb|AAG52275.1|AC019018_12 putative purple acid phosphatase; 85474-92788 [Arabidopsis thaliana] gi|332194749|gb|AEE32870.1| purple acid phosphatase 5 [Arabidopsis thaliana] Length = 396 Score = 75.9 bits (185), Expect = 3e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 277 YEPLYNSNNYHCMEGESMRVMLEPWFVQNKVDLVFAGHVHS 155 + P YNSNNYH MEGESMRV EPWFV+NKVD+VFAGHVH+ Sbjct: 250 HAPWYNSNNYHYMEGESMRVTFEPWFVENKVDIVFAGHVHA 290 >ref|XP_002886149.1| ATPAP11/PAP11 [Arabidopsis lyrata subsp. lyrata] gi|297331989|gb|EFH62408.1| ATPAP11/PAP11 [Arabidopsis lyrata subsp. lyrata] Length = 461 Score = 75.9 bits (185), Expect = 3e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 277 YEPLYNSNNYHCMEGESMRVMLEPWFVQNKVDLVFAGHVHS 155 + P YNSNNYH MEGESMRV EPWFV+NKVD+VFAGHVH+ Sbjct: 315 HAPWYNSNNYHYMEGESMRVTFEPWFVENKVDIVFAGHVHA 355 >ref|NP_179405.1| purple acid phosphatase 11 [Arabidopsis thaliana] gi|75265874|sp|Q9SI18.1|PPA11_ARATH RecName: Full=Purple acid phosphatase 11; Flags: Precursor gi|20257485|gb|AAM15912.1|AF492663_1 purple acid phosphatase [Arabidopsis thaliana] gi|4874290|gb|AAD31353.1| putative purple acid phosphatase precursor [Arabidopsis thaliana] gi|109946619|gb|ABG48488.1| At2g18130 [Arabidopsis thaliana] gi|330251635|gb|AEC06729.1| purple acid phosphatase 11 [Arabidopsis thaliana] Length = 441 Score = 75.9 bits (185), Expect = 3e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 277 YEPLYNSNNYHCMEGESMRVMLEPWFVQNKVDLVFAGHVHS 155 + P YNSNNYH MEGESMRV EPWFV+NKVD+VFAGHVH+ Sbjct: 295 HAPWYNSNNYHYMEGESMRVTFEPWFVENKVDIVFAGHVHA 335 >ref|NP_190198.1| purple acid phosphatase 19 [Arabidopsis thaliana] gi|75264317|sp|Q9LX83.1|PPA19_ARATH RecName: Full=Purple acid phosphatase 19; Flags: Precursor gi|7799000|emb|CAB90939.1| purple acid phosphatase precursor-like protein [Arabidopsis thaliana] gi|332644595|gb|AEE78116.1| purple acid phosphatase 19 [Arabidopsis thaliana] Length = 388 Score = 75.9 bits (185), Expect = 3e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 277 YEPLYNSNNYHCMEGESMRVMLEPWFVQNKVDLVFAGHVHS 155 + P YNSNNYH MEGESMRV EPWFV+NKVD+VFAGHVH+ Sbjct: 238 HAPWYNSNNYHYMEGESMRVTFEPWFVENKVDIVFAGHVHA 278