BLASTX nr result
ID: Cnidium21_contig00034234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034234 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270846.1| PREDICTED: uncharacterized protein LOC100262... 106 2e-21 emb|CAN64440.1| hypothetical protein VITISV_017550 [Vitis vinifera] 106 2e-21 ref|XP_004138201.1| PREDICTED: uncharacterized protein LOC101209... 99 5e-19 ref|XP_002512008.1| conserved hypothetical protein [Ricinus comm... 98 6e-19 ref|NP_197695.1| uncharacterized protein [Arabidopsis thaliana] ... 98 8e-19 >ref|XP_002270846.1| PREDICTED: uncharacterized protein LOC100262799 [Vitis vinifera] gi|297734138|emb|CBI15385.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 106 bits (264), Expect = 2e-21 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = +3 Query: 3 SLARASIIGLGSLVVGWICGSCLVPMIPSVLLQPTWTLELLTSLVAYVFLFVGCTFLK 176 SLARA IIGLGSLV GW+CGS LVPMIPS LL+PTWTLELLTSLVAYVFLF+GCTFLK Sbjct: 195 SLARAFIIGLGSLVAGWVCGSFLVPMIPSFLLRPTWTLELLTSLVAYVFLFLGCTFLK 252 >emb|CAN64440.1| hypothetical protein VITISV_017550 [Vitis vinifera] Length = 235 Score = 106 bits (264), Expect = 2e-21 Identities = 51/58 (87%), Positives = 54/58 (93%) Frame = +3 Query: 3 SLARASIIGLGSLVVGWICGSCLVPMIPSVLLQPTWTLELLTSLVAYVFLFVGCTFLK 176 SLARA IIGLGSLV GW+CGS LVPMIPS LL+PTWTLELLTSLVAYVFLF+GCTFLK Sbjct: 178 SLARAFIIGLGSLVAGWVCGSFLVPMIPSFLLRPTWTLELLTSLVAYVFLFLGCTFLK 235 >ref|XP_004138201.1| PREDICTED: uncharacterized protein LOC101209271 [Cucumis sativus] gi|449525099|ref|XP_004169557.1| PREDICTED: uncharacterized protein LOC101226625 [Cucumis sativus] Length = 251 Score = 98.6 bits (244), Expect = 5e-19 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = +3 Query: 3 SLARASIIGLGSLVVGWICGSCLVPMIPSVLLQPTWTLELLTSLVAYVFLFVGCTFLK 176 S+ARASIIG GSLVVGW+CGS +VP IPS LLQPTW+LELLTSLV Y FLF+ CTFLK Sbjct: 194 SVARASIIGFGSLVVGWVCGSLVVPSIPSFLLQPTWSLELLTSLVVYFFLFLSCTFLK 251 >ref|XP_002512008.1| conserved hypothetical protein [Ricinus communis] gi|223549188|gb|EEF50677.1| conserved hypothetical protein [Ricinus communis] Length = 256 Score = 98.2 bits (243), Expect = 6e-19 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = +3 Query: 3 SLARASIIGLGSLVVGWICGSCLVPMIPSVLLQPTWTLELLTSLVAYVFLFVGCTFLK 176 SL RA IIGLG+L GW+CGS VPMIP+VL+ PTWTLELLTSLVAY+FLFV CTFLK Sbjct: 199 SLGRAFIIGLGALAAGWVCGSVFVPMIPTVLIHPTWTLELLTSLVAYLFLFVACTFLK 256 >ref|NP_197695.1| uncharacterized protein [Arabidopsis thaliana] gi|9759362|dbj|BAB09821.1| unnamed protein product [Arabidopsis thaliana] gi|21928168|gb|AAM78111.1| AT5g23040/MYJ24_3 [Arabidopsis thaliana] gi|23505829|gb|AAN28774.1| At5g23040/MYJ24_3 [Arabidopsis thaliana] gi|62392260|dbj|BAD95465.1| cell growth defect factor [Arabidopsis thaliana] gi|332005729|gb|AED93112.1| uncharacterized protein [Arabidopsis thaliana] Length = 258 Score = 97.8 bits (242), Expect = 8e-19 Identities = 43/58 (74%), Positives = 51/58 (87%) Frame = +3 Query: 3 SLARASIIGLGSLVVGWICGSCLVPMIPSVLLQPTWTLELLTSLVAYVFLFVGCTFLK 176 SL RA +IG+G+LV GW CGS ++PMIP+ L+QPTWTLELLTSLVAYVFLF+ CTFLK Sbjct: 201 SLGRACLIGIGALVAGWFCGSLIIPMIPTFLIQPTWTLELLTSLVAYVFLFLSCTFLK 258