BLASTX nr result
ID: Cnidium21_contig00034231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034231 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEV42258.1| hypothetical protein [Beta vulgaris] 63 3e-08 dbj|BAL46523.1| hypothetical protein [Gentiana scabra x Gentiana... 61 8e-08 ref|XP_004154269.1| PREDICTED: uncharacterized protein LOC101204... 60 2e-07 ref|XP_004154025.1| PREDICTED: uncharacterized protein LOC101211... 60 2e-07 ref|XP_004153504.1| PREDICTED: uncharacterized protein LOC101213... 60 2e-07 >gb|AEV42258.1| hypothetical protein [Beta vulgaris] Length = 1553 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +3 Query: 348 KGKLSPRFVGPFVIKRRVGKVAYELDLPLSMQQVHNVFH 464 KGKLSP+F+GP+ I RVGKVAY LDLP +++VHNVFH Sbjct: 1404 KGKLSPKFIGPYEILARVGKVAYRLDLPNDLERVHNVFH 1442 >dbj|BAL46523.1| hypothetical protein [Gentiana scabra x Gentiana triflora] Length = 1152 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 348 KGKLSPRFVGPFVIKRRVGKVAYELDLPLSMQQVHNVFH 464 KGKLSPR+VGPF I R+GK+AY L LP SM +VHNVFH Sbjct: 1021 KGKLSPRYVGPFDIIERIGKLAYRLRLPESMSRVHNVFH 1059 >ref|XP_004154269.1| PREDICTED: uncharacterized protein LOC101204584 [Cucumis sativus] Length = 207 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +3 Query: 348 KGKLSPRFVGPFVIKRRVGKVAYELDLPLSMQQVHNVFH 464 KGKLSPRFVGPF I RVG VAY L LP S+ VHNVFH Sbjct: 88 KGKLSPRFVGPFEILERVGVVAYRLALPPSLSTVHNVFH 126 >ref|XP_004154025.1| PREDICTED: uncharacterized protein LOC101211634 [Cucumis sativus] Length = 207 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +3 Query: 348 KGKLSPRFVGPFVIKRRVGKVAYELDLPLSMQQVHNVFH 464 KGKLSPRFVGPF I RVG VAY L LP S+ VHNVFH Sbjct: 88 KGKLSPRFVGPFEILERVGVVAYRLALPPSLSAVHNVFH 126 >ref|XP_004153504.1| PREDICTED: uncharacterized protein LOC101213634 [Cucumis sativus] Length = 237 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = +3 Query: 348 KGKLSPRFVGPFVIKRRVGKVAYELDLPLSMQQVHNVFH 464 KGKLSPRFVGPF I RVG VAY L LP S+ VHNVFH Sbjct: 118 KGKLSPRFVGPFEILERVGVVAYRLALPPSLSAVHNVFH 156