BLASTX nr result
ID: Cnidium21_contig00034228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034228 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002489082.1| hypothetical protein SORBIDRAFT_0119s002010 ... 55 5e-06 ref|XP_002489083.1| hypothetical protein SORBIDRAFT_0118s002010 ... 55 5e-06 >ref|XP_002489082.1| hypothetical protein SORBIDRAFT_0119s002010 [Sorghum bicolor] gi|241947004|gb|EES20149.1| hypothetical protein SORBIDRAFT_0119s002010 [Sorghum bicolor] Length = 765 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 105 IATATVDRCFSTMKLVKSNLCNRIGDVFLSECII 4 +ATATV+R FS MK+VK+NLCNRIGD F+S C+I Sbjct: 714 VATATVERIFSGMKIVKTNLCNRIGDQFMSNCLI 747 >ref|XP_002489083.1| hypothetical protein SORBIDRAFT_0118s002010 [Sorghum bicolor] gi|241947003|gb|EES20148.1| hypothetical protein SORBIDRAFT_0118s002010 [Sorghum bicolor] Length = 762 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 105 IATATVDRCFSTMKLVKSNLCNRIGDVFLSECII 4 +ATATV+R FS MK+VK+NLCNRIGD F+S C+I Sbjct: 711 VATATVERIFSGMKIVKTNLCNRIGDQFMSNCLI 744