BLASTX nr result
ID: Cnidium21_contig00034140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034140 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531039.1| ATP binding protein, putative [Ricinus commu... 56 3e-06 >ref|XP_002531039.1| ATP binding protein, putative [Ricinus communis] gi|223529392|gb|EEF31356.1| ATP binding protein, putative [Ricinus communis] Length = 266 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 3 CIRKSSTWRPVMSEVLQVMLMEGEIDKERWKIPK 104 CIR S TWRP MSEVL+VM EGE DKERWK+PK Sbjct: 194 CIRASPTWRPTMSEVLEVM-QEGETDKERWKMPK 226