BLASTX nr result
ID: Cnidium21_contig00034124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034124 (453 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28269.3| unnamed protein product [Vitis vinifera] 55 5e-06 ref|XP_002272473.1| PREDICTED: transcription factor E2FB-like [V... 55 5e-06 >emb|CBI28269.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/52 (53%), Positives = 33/52 (63%), Gaps = 5/52 (9%) Frame = -1 Query: 435 LNSMTGKKAGIEWNEMGPLNDDYTMANISTPS-----SSAAEVPFAVKTTGR 295 + M + G+EWNE+ LNDDY MAN+STP SSAAEVP A T GR Sbjct: 395 ITDMWRTEPGVEWNELDALNDDYAMANVSTPQPQTPPSSAAEVPPAANTPGR 446 >ref|XP_002272473.1| PREDICTED: transcription factor E2FB-like [Vitis vinifera] Length = 457 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/52 (53%), Positives = 33/52 (63%), Gaps = 5/52 (9%) Frame = -1 Query: 435 LNSMTGKKAGIEWNEMGPLNDDYTMANISTPS-----SSAAEVPFAVKTTGR 295 + M + G+EWNE+ LNDDY MAN+STP SSAAEVP A T GR Sbjct: 406 ITDMWRTEPGVEWNELDALNDDYAMANVSTPQPQTPPSSAAEVPPAANTPGR 457