BLASTX nr result
ID: Cnidium21_contig00034021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034021 (578 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB64937.1| TdcA1-ORF1-ORF2 [Daucus carota] 55 8e-06 >dbj|BAB64937.1| TdcA1-ORF1-ORF2 [Daucus carota] Length = 988 Score = 55.1 bits (131), Expect = 8e-06 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = -1 Query: 419 YRAIHTGGSSSHRKTVAVLAEEYERDPYTPELFLYTHIRNHDLKTFVDKKNEKIY 255 Y HTGGS+S R AVLAE +DP +++L TH + D KTFV KK E +Y Sbjct: 810 YPPTHTGGSASLRTHAAVLAETNGKDPTPADVYLLTHTKKRDKKTFVTKKAEAVY 864