BLASTX nr result
ID: Cnidium21_contig00034005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00034005 (523 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514322.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago ... 55 5e-06 >ref|XP_002514322.1| conserved hypothetical protein [Ricinus communis] gi|223546778|gb|EEF48276.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 60.5 bits (145), Expect = 1e-07 Identities = 21/29 (72%), Positives = 24/29 (82%) Frame = -1 Query: 295 LKQCICSPTTHPGSFRCRHHHAEYVWGCR 209 +K C+CSPT HPGSFRCRHHH +Y WG R Sbjct: 58 IKMCVCSPTRHPGSFRCRHHHVDYAWGRR 86 >ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|222865848|gb|EEF02979.1| predicted protein [Populus trichocarpa] Length = 85 Score = 60.5 bits (145), Expect = 1e-07 Identities = 33/80 (41%), Positives = 42/80 (52%), Gaps = 2/80 (2%) Frame = -1 Query: 442 MCLAPSYLLREGSLVTRWHRHVLRAPTVVETRRQRLPRSMIPETDDS--SKLKQCICSPT 269 MC P +LV VL+A VET P + + +K+C+CSPT Sbjct: 1 MCHPPGVPWVSRNLVVYRRWLVLQA---VETETGHAPTEVAATGSSAVAGSIKKCLCSPT 57 Query: 268 THPGSFRCRHHHAEYVWGCR 209 HPGSFRCRHH ++YVWG R Sbjct: 58 RHPGSFRCRHHRSDYVWGGR 77 >ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|222873229|gb|EEF10360.1| predicted protein [Populus trichocarpa] Length = 88 Score = 58.2 bits (139), Expect = 7e-07 Identities = 31/78 (39%), Positives = 42/78 (53%) Frame = -1 Query: 442 MCLAPSYLLREGSLVTRWHRHVLRAPTVVETRRQRLPRSMIPETDDSSKLKQCICSPTTH 263 MC + + +LV R VL+A ET R + + S + +C+CSPT H Sbjct: 1 MCHPGVLSVSQRNLVVYQRRLVLQA-VETETSHARTEVAAGGGSAISRSINKCLCSPTRH 59 Query: 262 PGSFRCRHHHAEYVWGCR 209 PGSFRCRHH ++YVW R Sbjct: 60 PGSFRCRHHRSDYVWSGR 77 >ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago truncatula] gi|357521031|ref|XP_003630804.1| hypothetical protein MTR_8g103600 [Medicago truncatula] gi|355523664|gb|AET04118.1| hypothetical protein MTR_8g083460 [Medicago truncatula] gi|355524826|gb|AET05280.1| hypothetical protein MTR_8g103600 [Medicago truncatula] Length = 83 Score = 55.5 bits (132), Expect = 5e-06 Identities = 20/35 (57%), Positives = 26/35 (74%) Frame = -1 Query: 307 DSSKLKQCICSPTTHPGSFRCRHHHAEYVWGCRKL 203 + +KQC+CSP+ HPGSFRCR H A+YVW R + Sbjct: 48 EDGSIKQCVCSPSKHPGSFRCRQHQAKYVWRNRPI 82