BLASTX nr result
ID: Cnidium21_contig00033897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00033897 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB88875.1| pyrophosphate-dependent phosphofructo-1-kinase [P... 55 8e-06 >gb|AAB88875.1| pyrophosphate-dependent phosphofructo-1-kinase [Prunus armeniaca] Length = 282 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 310 ARLLSSTNQPSFLGPKNAVEVKNEPPPATQLLESENC 200 ARLLSSTNQP+FL PK+ +EV+ P TQLLE ENC Sbjct: 232 ARLLSSTNQPTFLNPKDVIEVQEGEEPPTQLLEGENC 268