BLASTX nr result
ID: Cnidium21_contig00033769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00033769 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633340.1| PREDICTED: pentatricopeptide repeat-containi... 69 3e-10 emb|CBI28420.3| unnamed protein product [Vitis vinifera] 69 3e-10 ref|XP_002869909.1| binding protein [Arabidopsis lyrata subsp. l... 66 3e-09 ref|NP_001078414.1| pentatricopeptide repeat-containing protein ... 66 3e-09 ref|NP_001078415.1| pentatricopeptide repeat-containing protein ... 66 3e-09 >ref|XP_003633340.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Vitis vinifera] Length = 679 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 1 LLSKIYDREIIVRDNSRFHHFKNGSCSCLDYW 96 LLSKIY REIIVRDN RFHHFKNGSCSC+DYW Sbjct: 648 LLSKIYSREIIVRDNCRFHHFKNGSCSCMDYW 679 >emb|CBI28420.3| unnamed protein product [Vitis vinifera] Length = 631 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 1 LLSKIYDREIIVRDNSRFHHFKNGSCSCLDYW 96 LLSKIY REIIVRDN RFHHFKNGSCSC+DYW Sbjct: 600 LLSKIYSREIIVRDNCRFHHFKNGSCSCMDYW 631 >ref|XP_002869909.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297315745|gb|EFH46168.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 595 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 LLSKIYDREIIVRDNSRFHHFKNGSCSCLDYW 96 L+SK+Y+REI+VRD SRFHHFKNGSCSC DYW Sbjct: 564 LVSKVYNREIVVRDRSRFHHFKNGSCSCQDYW 595 >ref|NP_001078414.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635630|sp|A8MQA3.2|PP330_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g21065 gi|332658994|gb|AEE84394.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 595 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 LLSKIYDREIIVRDNSRFHHFKNGSCSCLDYW 96 L+SK+Y+REI+VRD SRFHHFKNGSCSC DYW Sbjct: 564 LVSKVYNREIVVRDRSRFHHFKNGSCSCQDYW 595 >ref|NP_001078415.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658995|gb|AEE84395.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 462 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 LLSKIYDREIIVRDNSRFHHFKNGSCSCLDYW 96 L+SK+Y+REI+VRD SRFHHFKNGSCSC DYW Sbjct: 431 LVSKVYNREIVVRDRSRFHHFKNGSCSCQDYW 462