BLASTX nr result
ID: Cnidium21_contig00033716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00033716 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554581.1| PREDICTED: uncharacterized protein LOC100784... 61 8e-08 ref|XP_002515161.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 ref|XP_002320928.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|NP_001236491.1| uncharacterized protein LOC100306030 [Glycin... 60 2e-07 ref|XP_002302701.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 >ref|XP_003554581.1| PREDICTED: uncharacterized protein LOC100784735 [Glycine max] Length = 243 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 276 PIPNWRISSPGDAPKDVKARLKVWAQAVALA 184 PI NWRISSPGD P+DVKARLKVWAQAVALA Sbjct: 206 PITNWRISSPGDDPRDVKARLKVWAQAVALA 236 >ref|XP_002515161.1| conserved hypothetical protein [Ricinus communis] gi|223545641|gb|EEF47145.1| conserved hypothetical protein [Ricinus communis] Length = 295 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 276 PIPNWRISSPGDAPKDVKARLKVWAQAVALA 184 PI NWRISSPGD P+DVKARLKVWAQAVALA Sbjct: 257 PIANWRISSPGDDPRDVKARLKVWAQAVALA 287 >ref|XP_002320928.1| predicted protein [Populus trichocarpa] gi|222861701|gb|EEE99243.1| predicted protein [Populus trichocarpa] Length = 292 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 276 PIPNWRISSPGDAPKDVKARLKVWAQAVALA 184 PI NWRISSPGD P+DVKARLKVWAQAVA+A Sbjct: 254 PIANWRISSPGDDPRDVKARLKVWAQAVAIA 284 >ref|NP_001236491.1| uncharacterized protein LOC100306030 [Glycine max] gi|255627327|gb|ACU14008.1| unknown [Glycine max] Length = 240 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 276 PIPNWRISSPGDAPKDVKARLKVWAQAVALA 184 PI NWRIS+PGD P+DVKARLKVWAQAVALA Sbjct: 203 PIANWRISAPGDDPRDVKARLKVWAQAVALA 233 >ref|XP_002302701.1| predicted protein [Populus trichocarpa] gi|222844427|gb|EEE81974.1| predicted protein [Populus trichocarpa] Length = 234 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 276 PIPNWRISSPGDAPKDVKARLKVWAQAVALA 184 PI NWRISSPGD P+DVKARLKVWAQAVA+A Sbjct: 196 PIANWRISSPGDDPRDVKARLKVWAQAVAVA 226