BLASTX nr result
ID: Cnidium21_contig00033426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00033426 (613 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519358.1| leucine-rich repeat-containing protein, puta... 65 1e-08 ref|XP_002309943.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 ref|XP_002517696.1| TMV resistance protein N, putative [Ricinus ... 55 8e-06 ref|XP_002512273.1| leucine-rich repeat-containing protein, puta... 55 1e-05 >ref|XP_002519358.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223541425|gb|EEF42975.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 1108 Score = 64.7 bits (156), Expect = 1e-08 Identities = 40/95 (42%), Positives = 54/95 (56%), Gaps = 4/95 (4%) Frame = +1 Query: 52 VHNMTRNKMTVCHPTCYGIPEDD-EYMTWLSHWKFGSHEMGPGDEVNISI---FNYYDDH 219 ++N T+ PT Y +PEDD E M WLS+WKFG E GD+VN+S+ F YY Sbjct: 955 MNNETKGTNWSYSPTFYALPEDDDEDMLWLSYWKFGG-EFEVGDKVNVSVRMPFGYY--- 1010 Query: 220 SFEVKEIGVYLVYEEQEQTGVHLAERQKNSQYVIP 324 VKE G+ +VYEE E+ + Q N+ +IP Sbjct: 1011 ---VKECGIRIVYEENEK------DNQSNTADIIP 1036 >ref|XP_002309943.1| predicted protein [Populus trichocarpa] gi|222852846|gb|EEE90393.1| predicted protein [Populus trichocarpa] Length = 451 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/73 (41%), Positives = 47/73 (64%) Frame = +1 Query: 52 VHNMTRNKMTVCHPTCYGIPEDDEYMTWLSHWKFGSHEMGPGDEVNISIFNYYDDHSFEV 231 + N T+ +P YG+P+ E M WLSHW+FG+ ++ GD+VN+S D F+V Sbjct: 345 ISNKTKVLKWSYNPIVYGVPQIGEDMLWLSHWRFGTDQLEVGDQVNVSASVTPD---FQV 401 Query: 232 KEIGVYLVYEEQE 270 K+ GV+LVYE+++ Sbjct: 402 KKCGVHLVYEQED 414 >ref|XP_002517696.1| TMV resistance protein N, putative [Ricinus communis] gi|223543328|gb|EEF44860.1| TMV resistance protein N, putative [Ricinus communis] Length = 1186 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 5/87 (5%) Frame = +1 Query: 70 NKMTVCH-----PTCYGIPEDDEYMTWLSHWKFGSHEMGPGDEVNISIFNYYDDHSFEVK 234 N T+C PT YG+P+ E M WLSHW FG ++ GDEV+I + VK Sbjct: 1045 NNKTICEKWTYSPTFYGMPKPLEEMLWLSHWTFGD-QLEVGDEVHILV---EMASGLTVK 1100 Query: 235 EIGVYLVYEEQEQTGVHLAERQKNSQY 315 + G+ L+YEE E T +AE +S + Sbjct: 1101 KCGIRLIYEE-ESTTQEIAESSSSSSW 1126 >ref|XP_002512273.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223548234|gb|EEF49725.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 1166 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 1/89 (1%) Frame = +1 Query: 52 VHNMTRNKMTVCHPTCYGIPEDDEYMTWLSHWKFGSHEMGPGDEVNISIFNYYDDHSFEV 231 + N T++ P YGIPE ++ M WLSHWK G GD++N+S ++ Sbjct: 1032 IWNKTKDLKWTYSPIFYGIPEPEKSMLWLSHWKLEDLLEG-GDQLNVSAVM---STGYQA 1087 Query: 232 KEIGVYLVY-EEQEQTGVHLAERQKNSQY 315 K I ++LVY +E E+T ++ E ++N+ + Sbjct: 1088 KNIRIHLVYDQENEETELNSEETEENASF 1116