BLASTX nr result
ID: Cnidium21_contig00033280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00033280 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulg... 86 3e-15 ref|XP_002446122.1| hypothetical protein SORBIDRAFT_06g002025 [S... 65 4e-09 >ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435151|ref|YP_004222369.1| hypothetical protein BevumaM_p136 [Beta vulgaris subsp. maritima] gi|346683242|ref|YP_004842174.1| hypothetical protein BemaM_p130 [Beta macrocarpa] gi|9049306|dbj|BAA99316.1| orf107b [Beta vulgaris subsp. vulgaris] gi|317905601|emb|CBJ14008.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439884|emb|CBJ17584.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148038|emb|CBJ20702.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500160|emb|CBX24979.1| hypothetical protein [Beta macrocarpa] gi|384977914|emb|CBL54138.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 85.9 bits (211), Expect = 3e-15 Identities = 45/61 (73%), Positives = 48/61 (78%) Frame = -2 Query: 318 NHHTTRIDANPPRYRTCDSHRIRLAQRLLNPSRAFSFIPPLLSNPR*NLRSPGAN*MGVF 139 NHHTTRIDANPPRYRTCDSHRIRLAQRLLNPSRAFS PL S+ + L + MGVF Sbjct: 19 NHHTTRIDANPPRYRTCDSHRIRLAQRLLNPSRAFSSTFPLQSSIK--LAFSRRSEMGVF 76 Query: 138 P 136 P Sbjct: 77 P 77 Score = 70.9 bits (172), Expect = 1e-10 Identities = 48/93 (51%), Positives = 55/93 (59%) Frame = -1 Query: 319 QPPHYTYRREPPSLPYVRLSPHTARTKTPKSIPSLFFYSTSPLQSSIKLAFPRR*LNGGL 140 +P H+T R + Y H R PS F ST PLQSSIKLAF RR G+ Sbjct: 17 RPNHHTTRIDANPPRYRTCDSHRIRLAQRLLNPSRAFSSTFPLQSSIKLAFSRR-SEMGV 75 Query: 139 SFSPIVCIGLASSRTRGAFLRARACRKAGGSIS 41 SPIVCIGLASSR++ +LRARACRKA IS Sbjct: 76 FPSPIVCIGLASSRSK-LYLRARACRKADHYIS 107 >ref|XP_002446122.1| hypothetical protein SORBIDRAFT_06g002025 [Sorghum bicolor] gi|241937305|gb|EES10450.1| hypothetical protein SORBIDRAFT_06g002025 [Sorghum bicolor] Length = 132 Score = 65.5 bits (158), Expect = 4e-09 Identities = 37/57 (64%), Positives = 39/57 (68%), Gaps = 8/57 (14%) Frame = -2 Query: 318 NHHTTRIDANPPRYRTCDSHRIRLAQR--LLNPSRAFS------FIPPLLSNPR*NL 172 NHHTT IDANPP YRTCDSHRIRL R L + S S FIPPLLSNP+ NL Sbjct: 22 NHHTTCIDANPPPYRTCDSHRIRLTVRATLTDGSHKDSKIHPKLFIPPLLSNPQSNL 78