BLASTX nr result
ID: Cnidium21_contig00033168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00033168 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518980.1| PREDICTED: probable pectinesterase/pectinest... 65 4e-09 ref|XP_003536881.1| PREDICTED: probable pectinesterase/pectinest... 64 1e-08 ref|XP_003591503.1| Pectinesterase [Medicago truncatula] gi|3554... 63 2e-08 ref|XP_003591498.1| Pectinesterase [Medicago truncatula] gi|3554... 63 2e-08 ref|XP_003591484.1| Pectinesterase [Medicago truncatula] gi|3574... 63 2e-08 >ref|XP_003518980.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41-like [Glycine max] Length = 553 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -3 Query: 278 GFHIIDSTDAANFTVSNFVLGDNWIPQTGTPFSSNL 171 G+H+I++TDAANFTVSNF+LGDNW+PQTG ++SNL Sbjct: 517 GYHVINATDAANFTVSNFLLGDNWLPQTGVAYASNL 552 >ref|XP_003536881.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41-like [Glycine max] Length = 559 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/36 (69%), Positives = 34/36 (94%) Frame = -3 Query: 278 GFHIIDSTDAANFTVSNFVLGDNWIPQTGTPFSSNL 171 G+H+I++T AANFTV+NF+LGDNW+PQTG P++SNL Sbjct: 523 GYHVINATVAANFTVANFLLGDNWLPQTGVPYASNL 558 >ref|XP_003591503.1| Pectinesterase [Medicago truncatula] gi|355480551|gb|AES61754.1| Pectinesterase [Medicago truncatula] Length = 499 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 278 GFHIIDSTDAANFTVSNFVLGDNWIPQTGTPFSSNL 171 G+H+I +TDAANFTVSNF+ GD+WIPQTG P+SS L Sbjct: 463 GYHVIGATDAANFTVSNFLSGDDWIPQTGVPYSSRL 498 >ref|XP_003591498.1| Pectinesterase [Medicago truncatula] gi|355480546|gb|AES61749.1| Pectinesterase [Medicago truncatula] Length = 335 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 278 GFHIIDSTDAANFTVSNFVLGDNWIPQTGTPFSSNL 171 G+H+I +TDAANFTVSNF+ GD+WIPQTG P+SS L Sbjct: 299 GYHVIGATDAANFTVSNFLSGDDWIPQTGVPYSSGL 334 >ref|XP_003591484.1| Pectinesterase [Medicago truncatula] gi|357442455|ref|XP_003591505.1| Pectinesterase [Medicago truncatula] gi|355480532|gb|AES61735.1| Pectinesterase [Medicago truncatula] gi|355480553|gb|AES61756.1| Pectinesterase [Medicago truncatula] Length = 315 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 278 GFHIIDSTDAANFTVSNFVLGDNWIPQTGTPFSSNL 171 G+H+I +TDAANFTVSNF+ GD+WIPQTG P+SS L Sbjct: 279 GYHVIGATDAANFTVSNFLSGDDWIPQTGVPYSSGL 314