BLASTX nr result
ID: Cnidium21_contig00033108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00033108 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 ref|XP_002876707.1| hypothetical protein ARALYDRAFT_907889 [Arab... 57 1e-06 ref|NP_001078332.1| protein rotundifolia like 14 [Arabidopsis th... 57 1e-06 >ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|222861166|gb|EEE98708.1| predicted protein [Populus trichocarpa] Length = 64 Score = 69.3 bits (168), Expect = 3e-10 Identities = 27/45 (60%), Positives = 39/45 (86%) Frame = +3 Query: 48 MAANSFSVGCSKIRSWERCSKRIKQQRARVYIIWRCTVLLMNWHE 182 MAA++ S+ K+RSW+RCSK+I++QR R+YIIWRCTV+L+ WH+ Sbjct: 20 MAADALSMRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 58.9 bits (141), Expect = 4e-07 Identities = 21/34 (61%), Positives = 30/34 (88%) Frame = +3 Query: 81 KIRSWERCSKRIKQQRARVYIIWRCTVLLMNWHE 182 K RSW+RCS+ +K+QR R+YIIWRCTV+L++W + Sbjct: 13 KFRSWQRCSRLVKEQRTRLYIIWRCTVILLSWDD 46 >ref|XP_002876707.1| hypothetical protein ARALYDRAFT_907889 [Arabidopsis lyrata subsp. lyrata] gi|297322545|gb|EFH52966.1| hypothetical protein ARALYDRAFT_907889 [Arabidopsis lyrata subsp. lyrata] Length = 70 Score = 57.4 bits (137), Expect = 1e-06 Identities = 21/35 (60%), Positives = 32/35 (91%) Frame = +3 Query: 78 SKIRSWERCSKRIKQQRARVYIIWRCTVLLMNWHE 182 +K+R+W+RCSK+IK+QRAR+YIIW+C V L++ H+ Sbjct: 36 NKVRTWKRCSKQIKEQRARLYIIWKCAVFLLSSHD 70 >ref|NP_001078332.1| protein rotundifolia like 14 [Arabidopsis thaliana] gi|42822061|tpg|DAA02285.1| TPA_exp: DVL14 [Arabidopsis thaliana] gi|332646912|gb|AEE80433.1| protein rotundifolia like 14 [Arabidopsis thaliana] Length = 48 Score = 57.4 bits (137), Expect = 1e-06 Identities = 21/35 (60%), Positives = 32/35 (91%) Frame = +3 Query: 78 SKIRSWERCSKRIKQQRARVYIIWRCTVLLMNWHE 182 +K+R+W+RCSK+IK+QRAR+YIIW+C V L++ H+ Sbjct: 14 TKVRTWKRCSKQIKEQRARLYIIWKCAVFLLSSHD 48