BLASTX nr result
ID: Cnidium21_contig00033078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00033078 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAX96367.1| transposon protein, putative, CACTA, En/Spm sub-c... 54 1e-05 >gb|AAX96367.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza sativa Japonica Group] gi|77549130|gb|ABA91927.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza sativa Japonica Group] Length = 922 Score = 54.3 bits (129), Expect = 1e-05 Identities = 25/67 (37%), Positives = 41/67 (61%) Frame = -3 Query: 203 MEAGAKSWRDFKVNLVRYFLRTGRNPCETYSYISEDDWETFKKIHETDEFKEISEKAKES 24 ++ AKSWR +K+ L + F++TGR P TY+ I+ + W+ F + ++ E + S+K E Sbjct: 179 LQTMAKSWRGWKITLNKKFVKTGRTPFSTYANITPNQWDDFLTLKKSPEEIKRSQKYSEL 238 Query: 23 QKHNKDP 3 K NK P Sbjct: 239 AKKNKFP 245