BLASTX nr result
ID: Cnidium21_contig00033045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00033045 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143441.1| PREDICTED: DUF246 domain-containing protein ... 55 6e-06 gb|AFK40388.1| unknown [Lotus japonicus] 55 8e-06 >ref|XP_004143441.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] gi|449499794|ref|XP_004160919.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 513 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 6/55 (10%) Frame = +3 Query: 123 NQGGVIAIVFVLLT------LFTPFSHASSSFLPEFNAIKPRHLNLLRSAVQRQT 269 N+ G +A VFVLL LF+PF HAS S E+N KPRHL LL+SA+QRQ+ Sbjct: 10 NRAGALAGVFVLLFPVFLPGLFSPFGHASPSTFSEWNTPKPRHLRLLKSALQRQS 64 >gb|AFK40388.1| unknown [Lotus japonicus] Length = 502 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/55 (58%), Positives = 36/55 (65%) Frame = +3 Query: 105 MMLLHYNQGGVIAIVFVLLTLFTPFSHASSSFLPEFNAIKPRHLNLLRSAVQRQT 269 M L ++N + F LL FT FSHASS F PE N IKPRH LLRSAVQR+T Sbjct: 1 MELGNHNHAAATLVTFCLLFSFT-FSHASS-FYPELNPIKPRHSRLLRSAVQRET 53