BLASTX nr result
ID: Cnidium21_contig00032966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00032966 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281425.1| PREDICTED: putative nuclease HARBI1 [Vitis v... 61 1e-07 ref|XP_004147700.1| PREDICTED: putative nuclease HARBI1-like [Cu... 60 2e-07 >ref|XP_002281425.1| PREDICTED: putative nuclease HARBI1 [Vitis vinifera] gi|297746131|emb|CBI16187.3| unnamed protein product [Vitis vinifera] Length = 384 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = -3 Query: 295 LDIEDEVQYELPASQEHDPGYLQQVFKSSDKTSSGLREKLSFYVSGKLQP 146 +D+EDEVQ E+P S HD GY QQ+ +S+D +S +R+KLS Y+SG+L P Sbjct: 335 IDLEDEVQDEMPLSHHHDLGYRQQICESADNNASIVRDKLSLYLSGRLPP 384 >ref|XP_004147700.1| PREDICTED: putative nuclease HARBI1-like [Cucumis sativus] gi|449513511|ref|XP_004164345.1| PREDICTED: putative nuclease HARBI1-like [Cucumis sativus] Length = 392 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -3 Query: 295 LDIEDEVQYELPASQEHDPGYLQQVFKSSDKTSSGLREKLSFYVSGKLQP 146 +D+EDEVQ E+P S HDP Y QQ + D T+S REKLS Y+SGKL P Sbjct: 343 IDMEDEVQDEMPLSHHHDPSYRQQSCEFVDNTASISREKLSMYLSGKLPP 392