BLASTX nr result
ID: Cnidium21_contig00032799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00032799 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAC65222.1| hypothetical protein [Daucus carota] 86 4e-15 >dbj|BAC65222.1| hypothetical protein [Daucus carota] Length = 374 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = +2 Query: 2 LNESGDNGPSEFHTDPHMMHKKKRCCLPRDQDTPEYYYNLPADFIEKQRAYFK 160 LN SGD+ PSEF TDPHMMHKKKR C+PRDQDT E LPADFIEKQRAYFK Sbjct: 307 LNGSGDSEPSEFRTDPHMMHKKKRRCMPRDQDTLECI--LPADFIEKQRAYFK 357