BLASTX nr result
ID: Cnidium21_contig00032680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00032680 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516904.1| Mitochondrial deoxynucleotide carrier, putat... 114 1e-23 ref|XP_002314452.1| predicted protein [Populus trichocarpa] gi|2... 113 1e-23 ref|XP_003529575.1| PREDICTED: mitochondrial thiamine pyrophosph... 110 2e-22 ref|XP_003546375.1| PREDICTED: mitochondrial thiamine pyrophosph... 108 5e-22 ref|XP_003533430.1| PREDICTED: mitochondrial thiamine pyrophosph... 108 6e-22 >ref|XP_002516904.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] gi|223543992|gb|EEF45518.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] Length = 331 Score = 114 bits (284), Expect = 1e-23 Identities = 54/67 (80%), Positives = 57/67 (85%) Frame = -1 Query: 261 RHPKYGAALEPRAYTNMVDALYRILQKEGWAGLYKGIVPSVVKAAPAGAVTFVTYEFFSD 82 RHPKYGA +E RAY NM DAL RILQ EGWAGLYKGI+PS +KAAPAGAVTFV YEF SD Sbjct: 265 RHPKYGARVEHRAYRNMADALRRILQAEGWAGLYKGILPSTIKAAPAGAVTFVAYEFTSD 324 Query: 81 WLESTLT 61 WLES LT Sbjct: 325 WLESILT 331 >ref|XP_002314452.1| predicted protein [Populus trichocarpa] gi|222863492|gb|EEF00623.1| predicted protein [Populus trichocarpa] Length = 339 Score = 113 bits (283), Expect = 1e-23 Identities = 55/67 (82%), Positives = 56/67 (83%) Frame = -1 Query: 261 RHPKYGAALEPRAYTNMVDALYRILQKEGWAGLYKGIVPSVVKAAPAGAVTFVTYEFFSD 82 RHPKYG +E RAY NM DAL RILQ EGWAGLYKGIVPS VKAAPAGAVTFV YEF SD Sbjct: 273 RHPKYGGRVEHRAYRNMFDALRRILQTEGWAGLYKGIVPSTVKAAPAGAVTFVAYEFTSD 332 Query: 81 WLESTLT 61 WLES LT Sbjct: 333 WLESILT 339 >ref|XP_003529575.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Glycine max] Length = 331 Score = 110 bits (274), Expect = 2e-22 Identities = 51/65 (78%), Positives = 56/65 (86%) Frame = -1 Query: 261 RHPKYGAALEPRAYTNMVDALYRILQKEGWAGLYKGIVPSVVKAAPAGAVTFVTYEFFSD 82 RHP+YGA +E RAY NM+DA+ RILQ EGWAGLYKGI+PS VKAAPAGAVTFV YE SD Sbjct: 265 RHPRYGARVEHRAYRNMLDAMQRILQLEGWAGLYKGIIPSTVKAAPAGAVTFVAYELTSD 324 Query: 81 WLEST 67 WLEST Sbjct: 325 WLEST 329 >ref|XP_003546375.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Glycine max] Length = 328 Score = 108 bits (270), Expect = 5e-22 Identities = 52/67 (77%), Positives = 56/67 (83%) Frame = -1 Query: 261 RHPKYGAALEPRAYTNMVDALYRILQKEGWAGLYKGIVPSVVKAAPAGAVTFVTYEFFSD 82 RHP+YGA +E RAY NM+DA+ RILQ EGWAGLYKGIVPS VKAAPAGAVTFV YE D Sbjct: 262 RHPRYGARVEHRAYKNMLDAVKRILQMEGWAGLYKGIVPSTVKAAPAGAVTFVAYELTVD 321 Query: 81 WLESTLT 61 WLES LT Sbjct: 322 WLESFLT 328 >ref|XP_003533430.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Glycine max] Length = 328 Score = 108 bits (269), Expect = 6e-22 Identities = 51/67 (76%), Positives = 56/67 (83%) Frame = -1 Query: 261 RHPKYGAALEPRAYTNMVDALYRILQKEGWAGLYKGIVPSVVKAAPAGAVTFVTYEFFSD 82 RHP+YGA +E RAY NM+DA+ RILQ EGWAGLYKGI+PS VKAAPAGAVTFV YE D Sbjct: 262 RHPRYGARVEHRAYKNMLDAMKRILQMEGWAGLYKGILPSTVKAAPAGAVTFVAYELTVD 321 Query: 81 WLESTLT 61 WLES LT Sbjct: 322 WLESILT 328