BLASTX nr result
ID: Cnidium21_contig00032641
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00032641 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517792.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 ref|NP_191304.1| uncharacterized protein [Arabidopsis thaliana] ... 56 3e-06 >ref|XP_002517792.1| conserved hypothetical protein [Ricinus communis] gi|223543064|gb|EEF44599.1| conserved hypothetical protein [Ricinus communis] Length = 79 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/61 (47%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = +3 Query: 3 SHCPQTARLYYHPPA--DTHHRHLHGGVFGRVGEVSGQVGHGGSKGSMNNMDTAHVILYT 176 SHCPQTAR+YYHPPA D HH H GG + S +VG K +M MD I+ + Sbjct: 20 SHCPQTARMYYHPPANSDEHHHHHDGGSTATASDGSNRVGFCAPKAAM-RMDVKEFIICS 78 Query: 177 V 179 V Sbjct: 79 V 79 >ref|NP_191304.1| uncharacterized protein [Arabidopsis thaliana] gi|6706416|emb|CAB66102.1| putative protein [Arabidopsis thaliana] gi|21537251|gb|AAM61592.1| unknown [Arabidopsis thaliana] gi|98961017|gb|ABF58992.1| At3g57450 [Arabidopsis thaliana] gi|332646135|gb|AEE79656.1| uncharacterized protein [Arabidopsis thaliana] Length = 96 Score = 56.2 bits (134), Expect = 3e-06 Identities = 32/77 (41%), Positives = 40/77 (51%), Gaps = 17/77 (22%) Frame = +3 Query: 3 SHCPQTARLYYHPPADTHHRH-----LHG------------GVFGRVGEVSGQVGHGGSK 131 SHCPQTARLYYHPP+D HH H L G G+ G +G +G G G K Sbjct: 20 SHCPQTARLYYHPPSDNHHHHGGVKDLIGGGGVLGSGQNSTGLVGGLGTGTGTTGGCGIK 79 Query: 132 GSMNNMDTAHVILYTVV 182 S D ++L++VV Sbjct: 80 SSQVYDDARDLLLFSVV 96