BLASTX nr result
ID: Cnidium21_contig00032584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00032584 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32367.3| unnamed protein product [Vitis vinifera] 68 9e-10 ref|XP_002272356.1| PREDICTED: uncharacterized protein LOC100249... 68 9e-10 emb|CAN62851.1| hypothetical protein VITISV_010155 [Vitis vinifera] 68 9e-10 ref|XP_002517183.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 ref|XP_002520761.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 >emb|CBI32367.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 311 RQDCSHWCLPGVPDSWNELLYALFLKRVASLITNSS 204 RQDCSHWCLPGVPDSWNELLYALFLKR + NS+ Sbjct: 371 RQDCSHWCLPGVPDSWNELLYALFLKRESIRTRNST 406 >ref|XP_002272356.1| PREDICTED: uncharacterized protein LOC100249456 [Vitis vinifera] Length = 460 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 311 RQDCSHWCLPGVPDSWNELLYALFLKRVASLITNSS 204 RQDCSHWCLPGVPDSWNELLYALFLKR + NS+ Sbjct: 412 RQDCSHWCLPGVPDSWNELLYALFLKRESIRTRNST 447 >emb|CAN62851.1| hypothetical protein VITISV_010155 [Vitis vinifera] Length = 463 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 311 RQDCSHWCLPGVPDSWNELLYALFLKRVASLITNSS 204 RQDCSHWCLPGVPDSWNELLYALFLKR + NS+ Sbjct: 415 RQDCSHWCLPGVPDSWNELLYALFLKRESIRTRNST 450 >ref|XP_002517183.1| conserved hypothetical protein [Ricinus communis] gi|223543818|gb|EEF45346.1| conserved hypothetical protein [Ricinus communis] Length = 453 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 311 RQDCSHWCLPGVPDSWNELLYALFLKRVASLITNSS 204 RQDCSHWCLPGVPD+WNELLYALFLKR A+ N S Sbjct: 412 RQDCSHWCLPGVPDTWNELLYALFLKREAAKTFNLS 447 >ref|XP_002520761.1| conserved hypothetical protein [Ricinus communis] gi|223540146|gb|EEF41723.1| conserved hypothetical protein [Ricinus communis] Length = 466 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -3 Query: 323 SSRSRQDCSHWCLPGVPDSWNELLYALFLKRVASLITNSSK 201 +S RQDCSHWCLPGVPDSWNELLYAL LK+ A+ NS++ Sbjct: 420 ASLHRQDCSHWCLPGVPDSWNELLYALLLKKEAAHAQNSTE 460