BLASTX nr result
ID: Cnidium21_contig00032534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00032534 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632466.1| PREDICTED: pentatricopeptide repeat-containi... 76 3e-12 ref|XP_002522334.1| pentatricopeptide repeat-containing protein,... 75 6e-12 ref|XP_003542017.1| PREDICTED: pentatricopeptide repeat-containi... 68 7e-10 ref|XP_004152308.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-08 ref|XP_002324099.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 >ref|XP_003632466.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like, partial [Vitis vinifera] Length = 621 Score = 76.3 bits (186), Expect = 3e-12 Identities = 45/95 (47%), Positives = 57/95 (60%), Gaps = 6/95 (6%) Frame = +3 Query: 27 RRTTISFSSCAQTR------HLAAASSYTFDSHVKDLCDDNNYPQAIILLGENKRLPEAF 188 RR S S+ +Q + H S D VK LC DNN+ +AI +L E KRL EA Sbjct: 19 RRAICSSSTTSQPQLSKPPIHNTFFKSGAKDELVKRLCKDNNFKEAIDILCEQKRLREAI 78 Query: 189 ELLNRIDRPSPAIYSTLLELCTRQRALYLGKKVHA 293 ++L+ +DRPS A YSTLL+LC + RAL G KVHA Sbjct: 79 QILDHVDRPSAATYSTLLQLCLQLRALDEGMKVHA 113 >ref|XP_002522334.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538412|gb|EEF40018.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 507 Score = 75.1 bits (183), Expect = 6e-12 Identities = 34/64 (53%), Positives = 48/64 (75%) Frame = +3 Query: 99 DSHVKDLCDDNNYPQAIILLGENKRLPEAFELLNRIDRPSPAIYSTLLELCTRQRALYLG 278 DS + LC++ + +AI LL E RL EA ++LN+IDRPSP+IYS+L++ C + RAL +G Sbjct: 40 DSFIDRLCNEGRFKEAIALLCEQNRLKEAIQVLNQIDRPSPSIYSSLIQSCLKNRALEVG 99 Query: 279 KKVH 290 KKVH Sbjct: 100 KKVH 103 >ref|XP_003542017.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like [Glycine max] Length = 693 Score = 68.2 bits (165), Expect = 7e-10 Identities = 41/93 (44%), Positives = 59/93 (63%), Gaps = 3/93 (3%) Frame = +3 Query: 24 LRRT-TISFSSCAQTRHLAAASSYTFDSHVKDLC-DDNNYPQAIILLGENKRLPEAFELL 197 LRR+ + S SS + +RH + + KDL +DN + +A+ +L + KR+ EA ELL Sbjct: 19 LRRSFSFSSSSSSHSRHFQFRNDKRNHLNPKDLVSEDNKFEEAVDVLCQQKRVKEAVELL 78 Query: 198 NRID-RPSPAIYSTLLELCTRQRALYLGKKVHA 293 +R D RPS +YSTL+ C R RAL LG++VHA Sbjct: 79 HRTDHRPSARVYSTLIAACVRHRALELGRRVHA 111 >ref|XP_004152308.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like [Cucumis sativus] gi|449484855|ref|XP_004156999.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like [Cucumis sativus] Length = 724 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/65 (47%), Positives = 44/65 (67%) Frame = +3 Query: 99 DSHVKDLCDDNNYPQAIILLGENKRLPEAFELLNRIDRPSPAIYSTLLELCTRQRALYLG 278 D+++ LCD + +AI +L RL EA +LL RI++P +IY TLL+ C +QRAL G Sbjct: 79 DAYINRLCDSKLFKEAIDILCGQSRLREAVQLLYRIEKPYASIYLTLLKFCLKQRALKEG 138 Query: 279 KKVHA 293 K+VHA Sbjct: 139 KQVHA 143 >ref|XP_002324099.1| predicted protein [Populus trichocarpa] gi|222867101|gb|EEF04232.1| predicted protein [Populus trichocarpa] Length = 676 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/71 (42%), Positives = 46/71 (64%), Gaps = 6/71 (8%) Frame = +3 Query: 96 FDSHVKD------LCDDNNYPQAIILLGENKRLPEAFELLNRIDRPSPAIYSTLLELCTR 257 F S+ KD LC+ + +AI +L + RL EA ++L++ID+PS ++YSTL++ C + Sbjct: 23 FKSNTKDTTLVPHLCNHKRFDEAIHILCQQNRLKEALQILHQIDKPSASVYSTLIQSCIK 82 Query: 258 QRALYLGKKVH 290 R L GKKVH Sbjct: 83 SRLLQQGKKVH 93